SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012220 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012220
Domain Number 1 Region: 142-314
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.32e-60
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000504
Further Details:      
 
Domain Number 2 Region: 314-371
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000502
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012220   Gene: ENSTNIG00000009352   Transcript: ENSTNIT00000012411
Sequence length 371
Comment pep:known_by_projection chromosome:TETRAODON8:5:6119016:6121857:-1 gene:ENSTNIG00000009352 transcript:ENSTNIT00000012411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPHPQVTPSKRRTVLNISPPPQDLLDDSKMSCQDETSWDSEQSNSIWMEDSRSNFSIMSI
SSYNDNTEVPRKSRKRTPRQRPGPKSAPAEEASMDVFDADSAKGPHFVLSQLGPDSKTGA
KGSSSSDDPRTNKQKGGTLVMQYPQKSEGKELKILVQPETQHRARYLTEGSRGSVKDHSQ
QGFPTVKLEGVHEPVVLQVFVANDAGRVKPHGFYQACRVTGRNTTACKEVDIDGTTVIEV
SLDPSTNMTLAVDCVGILKLRNADVEARIGVAGSKKKSTRARLVFRVNIPRSDGSLLTLQ
TPSSPILCTQPAGIPEILKKSLHSCSVRGGEEVFIIGKNFLKDTKVIFQENVADEKSWKA
EAEIDMELFHQ
Download sequence
Identical sequences H3CVD6
99883.ENSTNIP00000012220 ENSTNIP00000012220 ENSTNIP00000012220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]