SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012390 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012390
Domain Number 1 Region: 62-107
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012390   Gene: ENSTNIG00000009517   Transcript: ENSTNIT00000012581
Sequence length 209
Comment pep:known_by_projection chromosome:TETRAODON8:5:9851199:9852452:1 gene:ENSTNIG00000009517 transcript:ENSTNIT00000012581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEFSPVLSIRDGGGRFAQPIFPRSRSGSESESELSQSLARTKIRSYGSTASVTASLGEK
YIEHRVTDSDTLQGIALKYGVTMEQIKRANKLFSNDCIFLRNSLNIPVVSQKRAIFNGLS
LESPDGDGDVAVQEADARYVVTQDIEGPSPPPSPPPTDSKASQPQPEELSAKDFLHRLDL
QIKQSKQAARRLKEEESFEEPSLGSYPEA
Download sequence
Identical sequences H3CVV6
ENSTNIP00000012390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]