SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012789 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012789
Domain Number 1 Region: 172-326
Classification Level Classification E-value
Superfamily E set domains 2.52e-31
Family Arrestin/Vps26-like 0.027
Further Details:      
 
Domain Number 2 Region: 11-169
Classification Level Classification E-value
Superfamily E set domains 2.03e-24
Family Arrestin/Vps26-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012789   Gene: ENSTNIG00000009898   Transcript: ENSTNIT00000012981
Sequence length 412
Comment pep:known_by_projection chromosome:TETRAODON8:12:1265626:1269437:-1 gene:ENSTNIG00000009898 transcript:ENSTNIT00000012981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGKVKSFTVSFDCLNDTNVPVFSSGDCVSGRVIIEVTGEIRVKSLKIHAKGLAKVRWT
ESRNAGSNTAYTQNYTEEVEYLNHKDILIGHERDDDNSEEGLTTIHSGRHEYAFSLELPQ
TPLATSFEGKHGSVRYWVKAELHRPWLLPMKTKKEFTVFEHIDINTPLLLSPQAGTKDKT
LCCWFCTSGPISLSAKIERKGYTPGESIQIFAEIENCSSRMVVPKAAIYQTQTFYAKGKM
KEVKQLVANLRGESLSSGKTETWSGKMLKIPPVSPSILDCSIIRVEYSLMVYVDIPGAIN
LSLNLPLVIGTIPLHPFGSRTSSVSSQCSMSWLGVGLPERPEAPPSYAEIVTEEQRQSGL
DVSAPREELDGPLFAYIHEFRFQPPPLYSEIDPNPDHARRTEERRLDACPSR
Download sequence
Identical sequences H3CX04
99883.ENSTNIP00000012789 ENSTNIP00000012789 ENSTNIP00000012789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]