SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013073 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013073
Domain Number 1 Region: 562-764
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-24
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 2 Region: 339-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-23
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 785-989
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-21
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 4 Region: 1161-1200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000446
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 5 Region: 1008-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000661
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 6 Region: 1-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000692
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 7 Region: 35-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000128
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 8 Region: 73-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000392
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1081-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000207
Family EGF-type module 0.022
Further Details:      
 
Domain Number 10 Region: 1130-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000922
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 272-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000935
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 12 Region: 1044-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000292
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 764-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000429
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013073
Domain Number - Region: 159-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0177
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013073   Gene: ENSTNIG00000010174   Transcript: ENSTNIT00000013265
Sequence length 1271
Comment pep:known_by_projection chromosome:TETRAODON8:1:19765504:19774829:-1 gene:ENSTNIG00000010174 transcript:ENSTNIT00000013265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSPNPCQNGALCRPRGDGYSCFCVPGFQGPRCQIDVNECASQPCRSGATCLDGRGRFSCL
CPPGLTGATCETQIDECQSQPCLDGDRCRDDPDGFTCICLSGSQGHRCENDTAESGTGLR
ARTERTCEQKSQSREPGLVPATAATVLLQQKTAAMPLRTSLNSATCPDTRGNHTCQCWPE
YPSAPSCDLTSVCSSSPACTEAGARGEKREQAHLFTPGLMLQAVALAQFCCWGQVMSEGC
SCHRGSAARSYLSELTCALSCVPSGSLCQEVINHCDPDPCQNGGRCEGRAGGYTCHCLKH
VRPGFAYAGPDCEERPVGCEGHACQNQASCVPSLSDGGPGYACSCPPGHAGPLCATPTTF
SFERRGYLVQQSPPVDAGAHCNITLSFRSVLPRAVLFQRNSRGLLLSLELDKGRLRLTLG
KAGAGGDGLGQVLELPHLVADGEWHSVETVLRSRVFSLNLLEDSGRCARQPCHKAAPVQS
SPDAWASPPQDTVFGGALQHPGGPDPEAPVPPFIGCMRDVFVDRQPVIPENGLGNSAVNV
SPGCSHRDRCLDGPCKNGGECVNLWQSYRCRCPRPYEGQDCQEELVTARFGSEDAHSYAA
FAVSEDLGPDLSVSFFLRTRRPGGFILALGNGSSQYLRLWLEDGGLAAQLHRLEILKSRS
PVDDGTVHFVSLEVEAGRLRLRVADEVQGEVEAGGVAVEAGHGVSVGELAAGGGTSVFGG
SLKGCIQDLRVNDRRLQFFPLDSWVESYPLRLMENVRAGCSGDDGCRRNPCLNGGTCSST
WDDFTCTCPPQTAGRRCEEVRWCELAPCPADSECRVLNRGFECYSNATFLNDSTVLTYRG
NGHVSRNLTSVSLNLRTRKRNAAVLHAERGSAFITVSVQDGFLFMELQSAAEAQAASTVS
LSSRSGVNDGQWHRLQLFMATPWAPTSRWTLVLDENIEEASVSRTKAGNLDFLRQDVDIF
LGGLAPDAGWALTGCLSTVELGGVALPYLSSSQVNLTRPQEEQFVQTVCDSKPCLNGGAC
RDLFNAYSCSCVDGWSGRRCEVLSDACASGPCVHGNCSARGPTFECACDFGFAGVNCDEK
ADVCQNHRCANGGTCLHGPDRYACLCPENFTGPLCRRPKFPVSVCGDETRNYTCFNGGNC
TDRELSCDCPPGFTGHRCEQELDECKSNPCQNGGYCHNLVNKFVCVCDMSYAGDVCQTDL
TPVGPTSDLLLSASLVSVLLLAALLLSSVGLAAAMGRRASRGTYSPSRQEKEGSRVEMWS
VTQTPPTERLI
Download sequence
Identical sequences H3CXT8
ENSTNIP00000013072 ENSTNIP00000013073 99883.ENSTNIP00000013073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]