SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013084 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013084
Domain Number 1 Region: 166-340
Classification Level Classification E-value
Superfamily E set domains 6.93e-31
Family Arrestin/Vps26-like 0.028
Further Details:      
 
Domain Number 2 Region: 5-166
Classification Level Classification E-value
Superfamily E set domains 1.33e-26
Family Arrestin/Vps26-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013084   Gene: ENSTNIG00000010185   Transcript: ENSTNIT00000013276
Sequence length 407
Comment pep:known_by_projection chromosome:TETRAODON8:1:19522730:19525502:1 gene:ENSTNIG00000010185 transcript:ENSTNIT00000013276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFDKLKKLDVVFDSPEVDRPPVFSSGDVVSGRVLLDLFGEVRVSSLKLHAEGFAKVHWT
ESRSAGSSTAYTQNYSDEVEYLNRREVLLQADNGEVSVLPAGRHEFPFSFQLPEETLVTS
FEGKHGSIRYWVKVKLHRPRATVKKIKKDFTVIEPIDINTPALLAPQAGTKDKLARAWYR
NFGQVSVTAKIDRKGYTPGEVIPVFAEFDNATSRSVVPKAFIIQTQTFIARGTMKQKRAV
VSTLCGDVVGAKCRETWHGRAIKIPPVGPSILHCRIIKVEYMLKVCVDVPGTSKLFLELP
LVIGTIPLHPFGSRTSSVSSQYSVNLEWLRMAIPEQPEPPPDYSSVVTEEEAEQQTSRET
PCEDLSGILGRPLMAFVQEFRFRPPPVYSEVDPNPQPFHMRPRCMTC
Download sequence
Identical sequences H3CXU9
ENSTNIP00000013084 99883.ENSTNIP00000013084 ENSTNIP00000013084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]