SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013482 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013482
Domain Number 1 Region: 497-646
Classification Level Classification E-value
Superfamily EF-hand 5.65e-49
Family Osteonectin 0.00000151
Further Details:      
 
Domain Number 2 Region: 439-494
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000018
Family Ovomucoid domain III-like 0.00033
Further Details:      
 
Domain Number 3 Region: 414-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000288
Family Follistatin (FS) module N-terminal domain, FS-N 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013482   Gene: ENSTNIG00000010569   Transcript: ENSTNIT00000013676
Sequence length 648
Comment pep:known_by_projection chromosome:TETRAODON8:18:2959486:2962732:1 gene:ENSTNIG00000010569 transcript:ENSTNIT00000013676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARCVFLCLLAATFALSVKSKPHGKHHKTLTVAPDKDIITEEANEPQAEPTLIPLEESR
RVEDPSSENNVDDKKEIRGVEMPERSSQSEEVPMGDEELAETLKREEGELEEEEEEEEEE
AEMEEGKEPAAEMTEDQEKMLNGKEEMEDAEEEADTEEELTEEDVMDAEMLDKEEVDVEM
MPLEGNVEKPAEEPAQTDERGALFEESDGSTESEIPADLDYAADSGLLQAPQTPTPPKQP
DSRLLLETGGKGGEEELPTATDDFEQEAEDGGKMSEDHEDKLATSKDEQDQKLNGVTPDL
EESSELLMSKTGRKEEQKSARHSKRKTKKQKKNQRVRKHFPQSEQPQSGEETSQQESESS
SAANTGSKAKRRRAGKWGSTVGMNPVQIRATVDLYPSSRSALAGHVHGPQAPADPCTDFP
CKRGKTCKLDGDNKPGCVCQQASECPPSMNDFDRVCGTDNQTYESSCQLFATKCNLEGTK
RGHRLHLDYTGACKLIPPCLDTELVQFPLRMRDWLKNVLLQLYEHDSSTSSFLTPKQRLK
VKKIFESDRRLHAGNHSVELLAQDFEKNYNMYIYPVHWQFAQLDQHPSDRSLSHSELAPL
RVPLVPMEHCTSRFFQECDADKDKQVSFQEWTACFGIKDEDMDVNQLF
Download sequence
Identical sequences H3CYZ7
ENSTNIP00000013481 99883.ENSTNIP00000013482 ENSTNIP00000013482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]