SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014127 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014127
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily E set domains 2.17e-69
Family Arrestin/Vps26-like 0.0000015
Further Details:      
 
Domain Number 2 Region: 186-377
Classification Level Classification E-value
Superfamily E set domains 2.94e-48
Family Arrestin/Vps26-like 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014127   Gene: ENSTNIG00000011192   Transcript: ENSTNIT00000014323
Sequence length 388
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92253373:92255736:1 gene:ENSTNIG00000011192 transcript:ENSTNIT00000014323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAIMKVFKKVSRDQSLTVYMDKRDFVDRCDSVQPVDGVIVVDPQQLRGRKVYVMLSCTF
KYGRQDMDVMGVAFRRDLFVVTRQVYPELQDKEQLTHTKVQQRLLQKLGDNAFPFFFEFP
DNLPCSVALQPGPSDVGKKCAVEFEVKGFCGQNQDDRQDKQSSVRLSIRKVQFSPADSGL
VPVAETTFEFFVMSEKPLHVRLSLARETFYHGEPVPVSLEINNSSSRTVKDISLSVEQVT
TVVLYSNDKYVKSVAKEETSDQVAPGTSLKKDYALYPLLAYNRERRGIALDGRLRHEDTN
LASSSIVKQEVLKEVQGMLVSYKLVVRMMACGTIGSSEVSLELPFRLMHPKPEPAKDSES
GDMVFEEFKRAYLKGVVYGDDDESPAEA
Download sequence
Identical sequences H3D0U1
ENSTNIP00000014127 99883.ENSTNIP00000014127 ENSTNIP00000014127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]