SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014961 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014961
Domain Number 1 Region: 140-454
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.1e-120
Family Transglutaminase core 0.00000000426
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily E set domains 1.19e-31
Family Transglutaminase N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 461-576
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.5e-27
Family Transglutaminase, two C-terminal domains 0.00033
Further Details:      
 
Domain Number 4 Region: 577-676
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-23
Family Transglutaminase, two C-terminal domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014961   Gene: ENSTNIG00000012000   Transcript: ENSTNIT00000015163
Sequence length 677
Comment pep:known_by_projection chromosome:TETRAODON8:9:1186576:1190120:1 gene:ENSTNIG00000012000 transcript:ENSTNIT00000015163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSDMERCDLNIKTNNTDHRTDRYGDKRLVVRRGQPFTLFFLLKPGSTALKPSETSFTVQT
GPLPQKKSNTKVSFGLSGSTPDTEWRASATDGPSEKTVCVSITSAPTAPVGLYALSVKLE
GQKTKLGEFVLLFNAWCLRDAVYMRSETKRQEYVLSQHGQIFRGTSKRIKGTPWSYGQFD
PDILDICLKILDANPKFVSDADQDCSARRDPVYVTRVLSAMINSNDDMGVLVGQWSDFTD
GVHPGSWTGSADILRRWAESGPVCYGQCWVFAAVACTVSRALGIPCRVVTNFGSAHDSNA
NLIIENLYDEDGEDFLGYDSIWWNFHVWVESWMTRPDLGPDFDGWQTSDPTPQETSEGVY
CCGPAPVRAIKEGELTVKYDAPFIFAEVNADVVDLVRLKDGKTVRIGGSTKSVGQFISTK
AVGSDERHDITHQYKYPEGSEEERQVYEKAQHHNKLQKRGEEPGLRLKIKLVDSVVVGWD
FEVFAVLTNNCMEARTCSFLFFARTVSYNGKLGDTCGVISEKVEVPPGGEKRLSLRLEYQ
SYGSKLTSDRLIQLSAVAMDKNSMDFQKAEKNIVLDDPDIQIKLVGEARAKGLLTAELTL
VNSLPEVLKDCSFTLEGVGLTEGGALTHSIGDVGPGQEARASVQLCPSRAGATVLLVNFH
SDKLTNVRSFINVVIGE
Download sequence
Identical sequences H3D373
ENSTNIP00000014961 ENSTNIP00000014961 99883.ENSTNIP00000014961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]