SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015515 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015515
Domain Number 1 Region: 401-481
Classification Level Classification E-value
Superfamily E set domains 6.24e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000898
Further Details:      
 
Domain Number 2 Region: 572-679
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000056
Family Ankyrin repeat 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015515
Domain Number - Region: 900-994
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00252
Family Motor proteins 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015515   Gene: ENSTNIG00000012546   Transcript: ENSTNIT00000015721
Sequence length 1055
Comment pep:known_by_projection chromosome:TETRAODON8:9:8450582:8491608:1 gene:ENSTNIG00000012546 transcript:ENSTNIT00000015721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQCLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVPAIEDCGKPCGPILCSINTDK
KEWAKWTKEELIGQLKPMFHGIKWTCSNGNSSGFSVEQLVQQILDSHQTKPPPRTHNCLC
TGTLGAGSSVHHKCNSAKHRIISPKVDPRSGGYSSAHSEVQNNDVSEGKTEHSSHGGGKC
PGGGAGGGSAREKRNGKVHKPTLLHQNSTEVSSTNQVEVPDTTQNSPVSISSGLNSDPDM
ADSPVVTDFDPDCFLNNPKQGQTYGGSAMKTEGSSSSSSSSGNSSSANGSLQRSPSISDG
GYAFSSALNQNRSPNFFLQDASQTAQAQQQRTPPPPPSGSPGSTQSKLCLQPCCSPQSLS
GGAGGGGSTGEAGSLSYMTEVVSAAVAQGMGMLQATGRLFMVTDYSPEWSYPEGGVKVLI
TGPWQEASSNYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAISNQIISNSVVFE
YKARALPSLPSSQHDWLSLDDNQFRMSILERLEQMERRMAEMASHQQPSSAGSGGTCVSG
QMQASSSFESRVVVVCEKMMSRACWAKSKHLIHSKTFRGMTLLHLAAGQGYANLIQTLIK
WRTKHADSIDLELEVDPLNVDHFSCTPLMWACALGHLEAAVILYKWDRRALAIPDSLGRL
PLSIARSRGHTKLAECLEQLQSLEQQQLHKLSASPKSVSSEGPSADKCLPMGSSTGTTRW
TSRESYSSNSLGRKAVGVGASGSLGKEKLVNRLRQRDQLGMLVMADREMTDAELLSYRED
LENQDCLTQMDDLQVNMMTLAEHIIEATPERIKRENFSPADSLPLDTSGVSNTMNWLANY
LGDVEQLPSIIHLREGALERSTLPSPADWSEFINASNSKVERDLAQLTLSDPEQRELYEA
ARLVQTAFCKYKGRPLREQQEVAAAVIQRCYKKYKQLTWIALKYALYKKMTQAAILIQSK
FRSYHEQKKFQQSRRAAVLIQQYYRSYKEFGRLKPPHRGAAAALVQHKLRGSLLTKRQDQ
AARKIMRFLRRCRHRVKELKRAREHETLQKSPLTM
Download sequence
Identical sequences H3D4S6
ENSTNIP00000015515 99883.ENSTNIP00000015515 ENSTNIP00000015515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]