SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015599 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015599
Domain Number 1 Region: 116-260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000113
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 35-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000375
Family EGF-type module 0.019
Further Details:      
 
Domain Number 3 Region: 75-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000609
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015599
Domain Number - Region: 517-811
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00632
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015599   Gene: ENSTNIG00000012627   Transcript: ENSTNIT00000015806
Sequence length 812
Comment pep:known_by_projection chromosome:TETRAODON8:3:8681338:8685781:1 gene:ENSTNIG00000012627 transcript:ENSTNIT00000015806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGALAQCTQEGGCVCLTGYELPSTVVPTSDAFGCVDIDECSEIGFCGQNAFCNNINGGFI
CTCLNGFNINQLLFADDDECLANICGDNGDCLNNIGSFQCTCHQGYYVAMDAVPVCQVNQ
TLSSSDINECSNLTICGPEALCTNKPGTFTCACNAGWAPTDRKEEPRDAINVCIADIGEC
VEELTICGPNANCTNVIGSYNCTCNSGYRLNNLNLIASVTNPCTDIEECVETPGICGRNT
VCTNVPGTFFCSCPDGFYPSTGIMWVVGTSFCKNIAVHIKHDRITNISLPLTFAGPNKRA
GLPGPNESRTEEQHRCLLASCITNSLSATMEVSGVGPRARSITVSSKGDAEAGSIILDIS
DRLVTTMVRSKYNQTQKSVQTLTVDMSLEKIDAENKEANYVALSARGQALDMNLQDLANG
NNATGSATVALMTLSGMESLLSHQYFKTVNRTEMNSDVFTVLLPAVNNTNLTEPVNFTIQ
HKKKIPENGIVTCVYWEDNKEEGEGGQSHGEMRWSTKGCWISFAHENYTVCSCSHLSTFA
LIMQIAEPAPANPFLEWLNRVCVIVGLFFFGLAIFTFLLCSWNPKINNTARLHLCLNLSM
SHLLLLWNEEYVENELACTVMAGLLHFLVIASFVWMLLEALQLHLLVRRLTKVQVIQRDG
LPRPLLYLIGYGVPFTIVGVSALVYSDGYGATEAKMCWLSQTRHFNWALTGPVIAILGIN
WILFCATLWCLRPTLANMRSDISQSKDTRLILFKIVAQFVILGCTWILGLYQTNLFFQVL
FIILNSQQGTFLFIVHCLLNKEVRDEYIKWLT
Download sequence
Identical sequences H3D510
99883.ENSTNIP00000015599 ENSTNIP00000015599 ENSTNIP00000015599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]