SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015932 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015932
Domain Number 1 Region: 150-297
Classification Level Classification E-value
Superfamily EF-hand 1.4e-50
Family Osteonectin 0.000000323
Further Details:      
 
Domain Number 2 Region: 92-146
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000194
Family Ovomucoid domain III-like 0.00019
Further Details:      
 
Domain Number 3 Region: 67-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000653
Family Follistatin (FS) module N-terminal domain, FS-N 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015932   Gene: ENSTNIG00000012953   Transcript: ENSTNIT00000016143
Sequence length 299
Comment pep:known_by_projection chromosome:TETRAODON8:1_random:871613:874630:1 gene:ENSTNIG00000012953 transcript:ENSTNIT00000016143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVWILFVLCLAASARAAPAEEEAFVEELVTEEPVVEEPEVGANPVQIEVGEFDEAIEIV
EDDAVENACLNHHCKKGKVCEVDESNTPMCVCQDPTTCPPAEAEFEHVCGTDNKTYDSSC
HFFATKCAEGTKKGHKLHLDYVGPCKFIEPCVDSELHEFPLRMRDWLKNVLVTLYERDLD
HNLLTEKQKLRVKKIYENEKRLQAGDHSLDLLAHDFKKNYNMYIFPVHWQFGQLDQHPAD
GYLTHSELSPLRAPLIPMEHCTTRFFEECDADSDNYIALEEWAACFGVKEQDIDKELVI
Download sequence
Identical sequences H3D5Z2
ENSTNIP00000015932 ENSTNIP00000015932 99883.ENSTNIP00000015932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]