SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015973 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015973
Domain Number 1 Region: 163-320
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 3.27e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000822
Further Details:      
 
Domain Number 2 Region: 16-165
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.27e-65
Family DNA-binding protein LAG-1 (CSL) 0.0000101
Further Details:      
 
Domain Number 3 Region: 321-433
Classification Level Classification E-value
Superfamily E set domains 2.33e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015973   Gene: ENSTNIG00000012994   Transcript: ENSTNIT00000016184
Sequence length 489
Comment pep:known_by_projection chromosome:TETRAODON8:20:1302043:1309854:-1 gene:ENSTNIG00000012994 transcript:ENSTNIT00000016184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLCLCRKFGERPQPQRLTREAMRNYLKERGDQTVMILHAKVAQKFYGNEKRFFCPPPCV
YLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDS
DKRKHFMLSVKMFYGNSADIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRL
RSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDEESEGEEFTVRDGYIHYGQTVKLVCS
VTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPC
PKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVHAPVTPVPVVESLQLNGGGDVAMLEL
TGQNFTPNLRVWFGDVEAETMYRCAESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDG
IIYSTTLTFTYTPEPGPRPHCSAAGAILRAGNSSLLSSNSQEAGPGVYGPDSTSSVGVTS
SSSTAAAVV
Download sequence
Identical sequences H3D633
ENSTNIP00000015973 99883.ENSTNIP00000015973 ENSTNIP00000015973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]