SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016855 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016855
Domain Number 1 Region: 1201-1315
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-16
Family Pentraxin (pentaxin) 0.011
Further Details:      
 
Domain Number 2 Region: 142-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 3 Region: 203-271
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000792
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1119-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000507
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 5 Region: 1157-1198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000541
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 6 Region: 968-1086
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 1081-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000502
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 8 Region: 760-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000151
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 9 Region: 257-318
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000528
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 10 Region: 491-544
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000556
Family Complement control module/SCR domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000016855
Domain Number - Region: 44-192
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000298
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016855   Gene: ENSTNIG00000013851   Transcript: ENSTNIT00000017069
Sequence length 1322
Comment pep:novel chromosome:TETRAODON8:Un_random:1079504:1101676:1 gene:ENSTNIG00000013851 transcript:ENSTNIT00000017069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEPKEQHCYLVPNFAEFEALARHALHEDLPTGSYIQEDLSLCSSLCEAGKDCCDLMAS
CKCGTHTGQYDCICEKGYYGKGLQHECTACPPGTYKPEAAPGGPGTCLACPDQHTSQPGS
TSVTDCVCKPGYRPLGMTCPVVYCPALPPPENGFFIQNVCNNHFEAACGVRCLPEFDLKG
TSIRLCQADGTWSGTPASCTVRSCPPLSRPKNGFLRCSNSGASNRTVCQVGCERGYNLEG
RSRLACQANSLWSGPQPRCVEVRCPPITTLRNITLSPPACGKRTVTPGSSCLLTCRKGFT
LLGNRKVVCLGSGNWTANIHTVICADAEPPWIQCPGDIVAGTDERRGTANVSWNVPTATD
NSNEEVAVQVKPVYAPPQLFPIGNETITYIATDHSGNQANCSFAVTVVDTEPPVIDRCRS
PPTVQAADIQTAVVWEVPQFSDNSGGRLTLTSSHTPGSQFPVGETLVQYTATDAAGNSRT
CNLTITVQGTTCDQPYSPVNGEFICSDEEEGVNCTLRCKDGYSITQDAVHSYFCAYNGVW
EPPYSPDRPDCSVNRIANNGFKPFEMLFKASRCDDMDLVKKFTGEFNTKLRSLLPNICSS
GDVTCKLEMMPQGHCLEYNYDYENGFSIAPGGWSNSWGTQGNQDYAYFESGFATGTRPLA
RQQRDTAKRPHPLSNRQRRIRRPTRDQKIQIFFNITASIPLPVSRNESIEVANQRRLLRT
LEQLTNRLKRTLARQPLSSFHVSSEMIVADPKSLEGRRAFLSCRPGSVLKGRMCVQCPVG
TYFSVEHNECVSCWRGSYQDQEGQVECKSCPEGSSTAYLHSRSISECKGQCKPGTHSPNG
LEICESCPMGHYQPDYAARDCLTCPPETSTVTRGAVDEAECGVPCLAGHFSRTGLVPCYP
CPRDYYQPDHGRSYCLSCPFYGTTTNVGATTIQRCSSFSSSFLPKEESVTAAPEVEVSED
YQASSQVFHECFLNPCQNKGTCEEIGAGYICTCMPGFTGAKCEVDIDECDSAPCQNGGLC
KDGMGEFQCQCKPGFLGSLCEAEVNECISFPCLNEGVCVDEVNKFSCSCAAGFTGSRCEL
EINECLSNPCVNGGVCEDQAGGYVCNCPVGFSGDHCEVNVDECYSAPCLNGGQCQDGIDS
FRCRCPLGYRGHLCEVNIDECDPNPCVNGASCLDGLGSYTCRCLPGFNGTRCETEMSSAF
NLDFEVSGIHGYVMMDGVMPALTEITCTFWMRSTDTTNYGTPISYAVEGSDNAFLLIDYN
GWVLYVNGKQRITDCPAVNTGQWYHIGVSWRSWDGDWRIYINGKPSDGGKDLSVGTTIPG
VV
Download sequence
Identical sequences H3D8L4
ENSTNIP00000016855 ENSTNIP00000016855 99883.ENSTNIP00000016855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]