SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000017993 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000017993
Domain Number 1 Region: 157-353
Classification Level Classification E-value
Superfamily E set domains 3.08e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000402
Further Details:      
 
Domain Number 2 Region: 53-173
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-21
Family Voltage-gated potassium channels 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000017993   Gene: ENSTNIG00000014946   Transcript: ENSTNIT00000018217
Sequence length 515
Comment pep:known_by_projection chromosome:TETRAODON8:3:13723899:13730945:-1 gene:ENSTNIG00000014946 transcript:ENSTNIT00000018217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALRRKFGEDYQVVNTNRPTPFSAPVKKKRQRFVDKNGRCNVQHGNLGGETSRYLSDLF
TTLVDLKWRWNLLIFILTYTIAWLVMASMWWIIAYIRGDLNHGHDQDYTPCVANVYNFPS
AFLFFIETEATIGYGHRYITEKCPEGIILFLFQSLLGSIVDAFLIGCMFIKMSQPKKRAE
TLMFSQDAVISQRDGKLCLMFRVGNLRNSHMVSAQIRCKLIKSRQTPEGEFLPLDQCELD
VGFGTGADQLFLVSPLTICHEINPKSPFFDLSKRSLMNEQFEIVVILEGIVETTGMTCQA
RTSYTEDEVLWGHRFLPVMSLEEGFFRVDYSQFHSTFEVPTPPHSVKEHAEKNSLPSPLS
TPVPALPECHAARRDRVFSVDCISTEEERGHQGGTGGRLPSKLQRMSSSGKEDLQRKVLL
LSSQHSEKACSTGDLPLKLQRLSSSSGPEAENRLQLKSLKVGFEPMTQSTGDLYQHSLAP
TLAPAPAPMYSPLLSGAGRLEDKLPAKLRKMNADR
Download sequence
Identical sequences Q4RWI3
ENSTNIP00000017993 ENSTNIP00000017993 99883.ENSTNIP00000017993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]