SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018662 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018662
Domain Number 1 Region: 71-413
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.18e-104
Family Myeloperoxidase-like 0.00000000285
Further Details:      
 
Domain Number 2 Region: 30-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018662   Gene: ENSTNIG00000015589   Transcript: ENSTNIT00000018889
Sequence length 413
Comment pep:known_by_projection chromosome:TETRAODON8:12:4998484:5002196:-1 gene:ENSTNIG00000015589 transcript:ENSTNIT00000018889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKTFSACLVMNLLLLLLLEITSSAGDSNSVNPCCYYPCQHAGVCVRYGTDQYQCDCTGTG
FYGDNCTVPEFWTNIYVMLKPSPPLVHFILKHFQWFWDFVNNSFLQDVFMRFVLTVRIKL
IPIIPTYNTKYGYLNWESYYNTSYYTRILPPVPEDCPLPMGAIAIHTHTHRPFETLDNML
FCIFTHRETCSSGSWHSLSWNFLHLQVDGSNIYGDNLMRQLQLRLLKDGKLKYQLVNGEM
YPPTVNKVSVYMMYPETVPPEQRLVIGHELFGLVPGLSLYATLWLREHNRVCDILKEEHP
TWDDEQLFQTARLIVIGETIKIIIEDYVQHLSGYLFKLKFDPSLLFKEQFQYSNRIALEF
VHLYHWHSLMPDSFLIDGDDISLPEFLYNSSILTHYGVEKLVDSFSRQRAGQV
Download sequence
Identical sequences H3DDR9
99883.ENSTNIP00000018662 ENSTNIP00000018662 ENSTNIP00000018662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]