SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019061 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019061
Domain Number 1 Region: 1-452
Classification Level Classification E-value
Superfamily Sema domain 1.44e-107
Family Sema domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1307-1437,1617-1772
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-44
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 798-894
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000455
Family Other IPT/TIG domains 0.0084
Further Details:      
 
Domain Number 4 Region: 455-503
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000432
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 891-981
Classification Level Classification E-value
Superfamily E set domains 0.000000000356
Family Other IPT/TIG domains 0.047
Further Details:      
 
Domain Number 6 Region: 979-1087
Classification Level Classification E-value
Superfamily E set domains 0.000000462
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019061
Domain Number - Region: 1460-1557
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0145
Family Ubiquitin-related 0.028
Further Details:      
 
Domain Number - Region: 753-786
Classification Level Classification E-value
Superfamily Plexin repeat 0.017
Family Plexin repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019061   Gene: ENSTNIG00000015973   Transcript: ENSTNIT00000019289
Sequence length 1835
Comment pep:known_by_projection chromosome:TETRAODON8:13:9598659:9625222:1 gene:ENSTNIG00000015973 transcript:ENSTNIT00000019289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTSETTINNVVQDPQTGRIYLGAVNSIFQLGPSLQMQARAETGPKEDARACTPPASACQD
TKLMPNVNKLLLVHPSNGSLIVCGSRYRGICSLLNLTDVEQQLYYSDSKGERTYVASIED
NVNVVGVMSNFSKDGETFSVFLVGKGYGSLDSMKLISTRILQDYRDWVVFESIIETSTVQ
TIPFVPKFLHDFRLAFKEDGFVYFLFSRTLDGSDNKNLTFVSRLCEEDQHYYSHTELQLS
CGEDNRYNKVQAGYVATPGKELARAMSESGSLGMPESKFLFVVASSEEDERDSALCMYSL
RSINQRLVDIISACYSDSDEPAVDMPYFFKTAFCTSNIALQKDTLKNFKCGADFLPSPLA
SKPRFALKAKAQLTRPGLLTAVAVAVENDHTVAFLGNDQGGILKVHLTAEPSVYSETAGV
SVGGKVNRNLFFDLSHSHIYITTEKTITKVPVQTCLQKRDCQSCVRMEDPYCGWCVLEGR
CTRRSECRRAEEKNGWLWSPKKECVKIVSFYPPNLSRKKSETVTINIPSLPAIGLSDRLH
CTIASHRSEGKISDSGQVSCDLPKPSLIPQTPGDQDFVAVEIKLFVNESVELAAREFNFY
SCAATVRKSENTPCMACVASSWGCQWNTDDHTCSDMDKTSGPNIIKQRQGLKCPKFENPD
PGLIPVGYKTRIGFEGMNLERYQGRSFTIGTELMKSVEEEVNFDEHFYTFNGFNFSYDKS
PETNVLFYMKDKESGKKMDSTLNVTLYNCSVGRQDCSLCKSADMTYRCVWCAKQNACVYE
KLCNPEQQGVDDPYNTECPNPQITDIIPRFGPMRGEISITILGSNLGIHRDDIKSITVAG
EPCTHHAEKYSVSTSIVCEIGPINPSSQHWGQVEVEVKGEKRGMSFINFTYRDPIPEAVE
PSRGPKAGGTLITITGHFLITGSKEDVQVTIGGVGCTVESFGVNITCRTGEYRALTPSRS
TVKYGKSTTTTIPNVFQFVENPIVLGHNPKESFVCGGRNIVVTGSGFDFIQTAVMKVHGN
NMTAVEAGIELEYSSPEYVLHPDYVAHEKNDTVIQFRSPTVNSSLNQHVRTYIQLDNWVK
ELKPFDYYSDPIFYDLVKNVITEASIIIVTGRGFSKAMTAKEAQAFVGDVSCLVNTLQDE
KLFLDPPSTPPRARSRRQRRDTRPELLDLTIKFGKGEWVVGLVKYETKNDLSLYIIIPAV
IVPMLLIIAISVYCYRRKSQQAEREYEKVKHQLENLEESVRDRCKKEFTDLMIEMEDHTN
DLSEGRIPFLDYKTYTDRVFFLTSKDGANDVMITGRLEIPHARRGTVMQALNQFSNLLNS
KTFLINFIRTLERSNDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLELMEEYVHSKN
PKLMLRRSETVVERMLCNWMSICLYQFLKDSAGEPLYKLFRAIKHQIEKGPVDARVKKAK
YTLNDTGLLGDDVEYSVLTLQVLVQDEGPDVTSVKVLNCDTISQVKEKIIEQVYKNLPYS
QRPKVDSVTLALKTEWRPGSTGQILSDLDLTSQKEGRWKRINTLAHYNVRDNATLVLSRV
PQTQQNYDQNQENHEERNALLEDDKVFHLVRPADELDEIKSKRGSIKDKSMTKAITEIYL
TRLLSVKGTLQQFVDDFFRSVLCTGAVVPPAVKYFFDFLDEQALKHSVDDETIHIWKTNS
LPLRFWVNILKNPNFIFDIHVSEVVDASLSVIAQTFMDACTKSEHKLSRDSPSNKLLYAK
EISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEVSRSHTDKLKTQVALHQLYQYASKYYD
GIIASLDEDPAAQSKQLTLRLQQIAAALENKVTDL
Download sequence
Identical sequences H3DEW7
99883.ENSTNIP00000019061 ENSTNIP00000019061 ENSTNIP00000019061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]