SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019147 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019147
Domain Number 1 Region: 42-517
Classification Level Classification E-value
Superfamily Sema domain 8.76e-114
Family Sema domain 0.00000000768
Further Details:      
 
Domain Number 2 Region: 1085-1343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-77
Family Protein kinases, catalytic subunit 0.000000000938
Further Details:      
 
Domain Number 3 Region: 659-746
Classification Level Classification E-value
Superfamily E set domains 6.62e-16
Family Other IPT/TIG domains 0.047
Further Details:      
 
Domain Number 4 Region: 519-566
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000123
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 562-646
Classification Level Classification E-value
Superfamily E set domains 0.00000000216
Family Other IPT/TIG domains 0.046
Further Details:      
 
Domain Number 6 Region: 745-837
Classification Level Classification E-value
Superfamily E set domains 0.000000114
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019147   Gene: ENSTNIG00000016058   Transcript: ENSTNIT00000019375
Sequence length 1343
Comment pep:known_by_projection chromosome:TETRAODON8:13:11078561:11115524:1 gene:ENSTNIG00000016058 transcript:ENSTNIT00000019375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLCCLPAVPLLLLLLWALSASAEGHCDKSPETNKLNLSVSYELPTFTADSPIQNMVTLD
GIIYVGAVNRIYALAPDLTKLSEYHTGPLLANQTCGQKFANTSFGGGRKDNVNVALVLEN
IYDKGLFSCGSADNGVCRRHVLEDDVSQKSVDEQVYCFTDLKQDKGQPRDSDVVVSPSGS
QVLNVESNMIMFFVGNSEIPGLGNGIGSATHPHTMSLRKMKTSQNGFTFLSSQSYMDLIP
PLRGSYYLRYVYSFHSGPFTYFLTVQQVSKDSQAYHTRIVRMCSFDHDIRRYVEMPLECI
STDKRRRRSTEDVKVFNILQAANVTKVGSDVELQRQLKVEEDDDVLFAAFARGKPNSPEP
TPNSAICIMSLKHINDMFKMYMKKCNTVDLYHFTGSDTKSCYNVVCLHMSTCCAGKEGKY
RLQVTQFVQRLEYWHKELTNTLVTSINVVPVHGRAVAYLGTADGRHIQVVFSRSLRPHVN
IRLDSRPVSAGVVLPGQNLSEGALLLATGNKITKVPLIGPGCDQLTTCTSCLLSSRVTEC
GWCDGRCTRANQCPSSIWTQEYCTPVITKVFPTSGPIRGSTTVTICGLNFGFVKTESFKV
PLVTVEVAGAHCKLLRQDYINRWTEIQCSPMSAGNFTPSGHTVKVTSGHMVAKMDGFTFV
DPVISEIFPTFGPKSGSTMLTIRGASLDTGNKLEVTVGKAACNIQSLSPTMLTCKTSPYA
VPCKQPVKLTVDSVERQAPLLFTYNRDPIISSIQPSRSFVSGGCTVVAHGLFLQSGLQPQ
MILTTGQDAEVFHVSCVYGENGTSIHCTTPSLAKLALQPPVVTKVAFVLDGYMTEQKDLI
YVEDPLFQDPKLTSKDNKSIVELKGDRMDREAMKCQVLTVSNHSCESLTLVGNTLECTIP
TELQTTTSKELQVEWRQADSVIHLGNLMLAQEQDYTGLVVGSVCVSLLLLLLGSLLMWRR
NKNIDVVDLSEVWYDGRGHIQHLDRLANARSVSPTNEMVSHESVDYRTNLLEGSELTPWS
SDDVTFNSLNVLLVTLGSGMGLGMEGELVSPLLMAPVHIDPSCLHPDLLTEVQHVVIARE
QLLLHLNQVIGRGHFGCVFHGTLLEPDGQKQHCAVKSLNRITDLEEVSQFLKEGIIMKDF
SHPNVLSLLGICLPPEGSPLMVLPYMKHGDLRNFIRDEAHNPTVKDLMGFGLQVARGMEY
LASKKFVHRDLAARNCMLDESYTVKVADFGLARDVYDKEYYSVHNKSGVKLPVKWMALES
LQTHKFTTKSDVWSFGVLLWELMTRGAPPYSDVNSFDITVFLLQGRRLLQPEFCPDALYT
VMIECWHPNPERRHSYSELVSRL
Download sequence
Identical sequences H3DF53
ENSTNIP00000019147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]