SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019355 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019355
Domain Number 1 Region: 243-432
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.28e-78
Family BRCA2 helical domain 0.000000813
Further Details:      
 
Domain Number 2 Region: 600-735
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.35e-56
Family BRCA2 tower domain 0.0000682
Further Details:      
 
Domain Number 3 Region: 433-569
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.22e-44
Family Single strand DNA-binding domain, SSB 0.000009
Further Details:      
 
Domain Number 4 Region: 820-939
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-36
Family Single strand DNA-binding domain, SSB 0.0003
Further Details:      
 
Domain Number 5 Region: 572-600,737-819
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.46e-32
Family Single strand DNA-binding domain, SSB 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019355   Gene: ENSTNIG00000016261   Transcript: ENSTNIT00000019584
Sequence length 939
Comment pep:known_by_projection chromosome:TETRAODON8:16:4701118:4705074:1 gene:ENSTNIG00000016261 transcript:ENSTNIT00000019584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EALDCTKALLEDESLLLDGDLQPAADDRKRKGKRCPQFSLLVNLFVKPHTAVLIPEQPPL
KRRLLEEFDRTDGSSRGSALNPEKCSPNGIMGDRRVFKCSVSFQPNITTPHRSGTNYVET
SLPNTTPTKVSALRDSNENVKLDTPNSKTASTFVPPFKKSRNSSKTEEEEPKHHFIPPFT
NPCATSSTKKHTAGVTGNKPAEDVPRVTLAETASGEPVMSPGSEDPAAEAACMEDTLSRD
LFQHLHNVELARDMQGMRIRKKKRQTILPLPGSLFLKKSSGVTRIPLKSAVNGKPPARYT
PKQLYGLGVPLNVLEITSETAGSFRFSLQQFVKLESLTDKGGIQLADGGWLIPRNDGTAG
KEEFYRALCDTTGVDPKLISEEWVYNHYRWIVWKQASMERSFPEQLGSLCLTPEQVLLQL
KYRYDIEVDQSRRPALRKIMERDDTAAKTLILCVCGVVSRGSSPQKQGLGGVAAPSSDPQ
VENPFAVVWLTDGWYSIKAQLDGPLTSMLNRGRLPVGGKLIIHGAQLVGSQDACSPLEAP
ESIMLKIFANSSRRARWDAKLGFYRDPRPFLLPVSSLYNSGGPVGCVDIIILRSYPTLWM
ERKPEGGTVFRSGRAEEKEARRYNVHKEKAMEILFDKIQAEFEKEERDNRKPRSRRRTIG
DQDIKSLQDGEELYEAVGDDPAYLEAHLTEQQAETLQNYKRLLIEKKQAELQDRYRRAVE
TAEDGTGSCPKRDVAPVWRLSIADFMEKPGSVYQLNIWRPPSELQSLLKEGCRYKVYNLT
TTDSKKQGGNTTVQLSGTKKTQFEDLQASEELLSTYFQPRVSATFIDLQDPEFHSLCGEV
DLTGYVISIIDGQGFSPAFYLTDGKQNFVKVRCFSSFAQSGLEDVIKPSVLLALSNLQLR
GQATSPTPVLYAGDLTVFSTNPKEVHLQESFSQLKTLVQ
Download sequence
Identical sequences H3DFR1
ENSTNIP00000019355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]