SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019639 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019639
Domain Number 1 Region: 204-404
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.03e-55
Family Reprolysin-like 0.0000308
Further Details:      
 
Domain Number 2 Region: 423-497
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.96e-20
Family Blood coagulation inhibitor (disintegrin) 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019639
Domain Number - Region: 636-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0364
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019639   Gene: ENSTNIG00000016539   Transcript: ENSTNIT00000019869
Sequence length 870
Comment pep:known_by_projection chromosome:TETRAODON8:17:4681467:4690267:-1 gene:ENSTNIG00000016539 transcript:ENSTNIT00000019869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLGHFLFMLLVSWGTTSAEPLPHVKKYQTVIPQRLEDPSPSDDAAAHRTFPDVLRFSL
TITEQNYTLHLEKNKHLVGGSFTVTHFSDQGARVTTAPDLRDHCYYHGHVVGVEDSSASV
GLCSGIRGFVHVHGQIYLIEPLAEAETDGGLHAVYNYKHLRRKRSSCSHGNQTSYYDHVP
GPSGLFQLASLKRRGQSGERVGKPRTVELVVVVDHTEYKKIGSTKMVESRVLEVANHVDK
LYRPVGIRVMLVGLEIWSYRDLIDVSSDPELTLGRFLKWRQWSLLPRTKHDNAQLITGVD
FDGSTVGLANTNTMCTSNSGAVNEDHNKSPVGVASTIAHEMGHNLGLSHDVENCVCGSQT
TKRGCIMSESVGEAGLSIQGSSAAGSQQQLSTFLEEITPACLLDSPSTSRIYGGPVCGNA
FVEAGEECDCGTAKECRNPCCNATTCKLAAGAQCAAGECCHRCQLKATGSVCRPKSGDCD
LEEYCTGFSASCPRDAFTSNGLACNRGAGYCYNGQCPSHQQHCRRLWGPEAKMAVEACYL
QHGNCRKTLFNQKCSRRDQFCGKLLCSDGWEFPVTSKKFLYPLGNGKQCNEAGMNSEDNY
PPDLAMVPTGTKCGPNMVCYNQRCQDMKSVKPYATSDCSSKCNNRGVCNHENKCHCDPGW
APPYCDVLLSELPRETGSVVLPVSLAVGFLLLLVLVFGGLMCYIKKRPPVKRCLQSASGQ
SNPLFRSGSARGSPRLGPAHIGQPVFVESSATQACKPLFSSRATTAAPKPSRAAPEPPKN
PKPVAQPSQVQQVPRPPSSVGAEVSCCMQSLAPQKKPLPPSRPLPPVASKPVVKSKPPVP
PVKPKPSAYASSLPHTQLTSVILKKGPWPS
Download sequence
Identical sequences H3DGJ5
ENSTNIP00000019639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]