SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019993 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019993
Domain Number 1 Region: 775-1064
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.64e-79
Family Complement components 0.0000152
Further Details:      
 
Domain Number 2 Region: 1148-1268
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.22e-27
Family Alpha-macroglobulin receptor domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000019993
Domain Number - Region: 612-664
Classification Level Classification E-value
Superfamily E set domains 0.0518
Family Arrestin/Vps26-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019993   Gene: ENSTNIG00000016878   Transcript: ENSTNIT00000020224
Sequence length 1288
Comment pep:known_by_projection chromosome:TETRAODON8:10:2927963:2934735:1 gene:ENSTNIG00000016878 transcript:ENSTNIT00000020224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVRGYRGDSLVFSNSTALPFSLRNVSSFIQTDRSCYQPGETVRVRVVSLRLDQRPHKGR
VETRVLDPSGTAVDGREATGTLGMVLWEFSLSQMAPLGQWTITASANGVTDERTFTVEDH
ERPPFEMLFKTPPRVLVGDALSGSVRVLYPSGPPVHGTLVVSVSLASASVPAQTKEVRLQ
IYGSTQFFFGKDLLQSLYSSPGISGGSLRVTAGVTDSSTGLKVTKTVEVQVEEHQFLLQF
HQFPSSLKPSLYFYSTLSIQRYDSGPLGSEDRMHPAVIEVTQELTTMKAEAAILTLPVPE
DGNVHFSFRLKQEVLKLVIRAKFQSSEQTLRVYRNYSSPTGSYVQVSADTLPAQIGVPLQ
LHVESSFQWSELHYVVSSRGLLLAAGTKNSSWFSLTPSVSWSPEACVTVYCVRSDGELIS
DTVAVPTDQPNQASLEWSSPQARPGEQVALTVTAAEARFQVGVVVMGTHGDSPLADVGMN
AKQCFTSSALVFGSTGSLHSPTGVSVSLLPQRCSLRMLTNAMLQKQAQAEGPDGFKFSSS
GSEEGDFLTIETSWRRWMEDAETLLWIDSDVSENIWTSDKMSVPDGFTALRAVALVMSDN
LGLGFTPVPQQLSVTKDFSLALNVPSCLIRGEEIVLEVHVINHLERQMEVILLLAESETF
QFVLANRADASVVNAQKLTLGSHVSAVALFPVRPVALGPMDITVDAVSAEASDSLVWSVF
VKPGGVEQSFSKTLFLELPPSNHSISRSVSFSSPPHVVAGSRRTFVAYAGDILALSISHL
DSLVQRPLGCGEQNMIHFAPSIYVLLYLDKSTQDNQELRSQAVAYLKEGYLRQLSYQRED
GSFSAFGARDPSGSTWLTAFVLRCFLQAQAYMMVSQSVLTRAVTWLLEHQGPRGDFGEVG
RVIHTEMQAGLDDAPAALTAFVLIALLEDERYTGNVSLAQRYLEDKVSGGGLSNYSMCLA
AYALALANSPQAGRALDELRRRADLIDGVMMWSSSAGPPSPDWPPRSAQVEMTAYVLLAF
YRLGNLVEGIGLMKWLSEQRNHLGSFGTTQDTIVALQALAYYAAFSGAKAIDLGLSVSTP
TSPLVSQLHINSTNFLAYQSQEIDAAQDVNLNIYMEGRGFVIFQLNIFYNLDSRAFMQSL
HDAAEEEAFSLDVAVTLEADQNHMLLSICTRLQESQVVRQTGMVMVEAGLLSGFRLSPGA
LPPGSPLRNVEAQEDKVTLYLDSVNRTEVCIRLPLLRAHKVARVQDAVVQVYDYYEPTRR
ATRAYNSDTLRNSDSCFFCGVGCDGCRP
Download sequence
Identical sequences H3DHJ9
ENSTNIP00000019993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]