SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022103 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022103
Domain Number 1 Region: 158-354
Classification Level Classification E-value
Superfamily E set domains 1.17e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000322
Further Details:      
 
Domain Number 2 Region: 53-174
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.83e-21
Family Voltage-gated potassium channels 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022103   Gene: ENSTNIG00000018916   Transcript: ENSTNIT00000022340
Sequence length 457
Comment pep:known_by_projection chromosome:TETRAODON8:2:8057320:8064273:1 gene:ENSTNIG00000018916 transcript:ENSTNIT00000022340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRRKFGEDYQVVSTNRSITFSAPVKRKRQRFVEKNGRCNVQHGNLGGETSRYISDLF
TTLVDLKWRWNLLIFILTYTVAWLVMASMWWVIAYIRGDLSHGGHDSSYTPCVANVYNFP
SAFLFFIETEATIGYGHRYITEKCPEGIILFLFQSLLGSIVDAFLIGCMFIKMSQPKKRA
ETLMFSQDAVISQRDGKLCLMFRVGNLRNSHMVSAQIRCKLIKSRQTPEGEFLPLDQCEL
DVGFGTGADQLFLVSPLTICHEINSKSPFFDLSQRSLMNEQFEIVVILEGIVETTGMTCQ
ARTSYTEDEVLWGHRFLPVMSLEEGFFRVDYSQFHNTFEVPTPPYSVKEQEEKSLLTSPN
PLPVAPTPSSPLLGNIGRGGRRERLLSADCADHIEDQTTRLPKKLQRMSSTKEELLWKGL
KTGSALPRGKASRTGDLPLSIQRLRSSSIPVARQEHL
Download sequence
Identical sequences H3DNK4
ENSTNIP00000022103 99883.ENSTNIP00000022103 ENSTNIP00000022103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]