SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022559 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022559
Domain Number 1 Region: 295-423
Classification Level Classification E-value
Superfamily Plus3-like 4.71e-44
Family Plus3 0.000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022559   Gene: ENSTNIG00000019356   Transcript: ENSTNIT00000022798
Sequence length 650
Comment pep:known_by_projection chromosome:TETRAODON8:10:11919962:11925009:1 gene:ENSTNIG00000019356 transcript:ENSTNIT00000022798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVKKRKGRVVIDSDSEDSASDDNLDQELLSLAKRKRVDAGEQDEPVNKPAASTDSETSDS
DDEWTVGGTKGKKKGKQGKGSEKKNATKKKVHKATASGSSDGDSSAESSAPEEGEVSDSE
SNSSSSSSDSDSSEDEVFKDGYDDDLMGDAEDRARLEQMTEKEREQELFNRIEKREVLKR
RFEQEKRKLSQVQDAQVVMSHNKERRSKRDEKLDKKSQAMEELKAEREKKKNKTAELLAK
RQPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSRSSSFDDDEKEEIAPKSQPVSLPEELNR
IRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNSSSKPVYRVAEIVDVVETAKVYQLGSTR
TNKGLQLRHGADTRVFRLEFVSNQEFAESEFIKWKEAMMVAGMQVPTLDEITKKEQTIKE
ALNYKFNDKDIEDIVKEKDRFRKAPPNYAMKKTQLLKDKAMAEESGDGDRVKVIQDELNE
LEERAEALDRQRTKNISAISYINQRNRSWNIVESEKALVAEGQNAKNQQMDPFTRRQCKP
TMVSNARDPSVHAAILAHLNQKYGSGSGADPSSPEKNKVTNAKEKDVPKPTTDLSEDLFK
VHDFDVKIDLQVPSAEAKSLSVSSNALPVKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences H3DPW0
ENSTNIP00000022559 ENSTNIP00000022559 99883.ENSTNIP00000022559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]