SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001001 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001001
Domain Number 1 Region: 573-762
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-54
Family DBL homology domain (DH-domain) 0.000000019
Further Details:      
 
Domain Number 2 Region: 767-905
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-39
Family Pleckstrin-homology domain (PH domain) 0.000000536
Further Details:      
 
Domain Number 3 Region: 1056-1113
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000525
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 4 Region: 273-410
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000528
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 5 Region: 90-178
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000405
Family CRAL/TRIO domain 0.0093
Further Details:      
 
Domain Number 6 Region: 368-510
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000162
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001001   Gene: ENSTNIG00000014517   Transcript: ENSTNIT00000002587
Sequence length 1143
Comment pep:known_by_projection chromosome:TETRAODON8:3:6480678:6495580:1 gene:ENSTNIG00000014517 transcript:ENSTNIT00000002587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VACVDIATDSSVPLPSDDIVQQDSGPLCAAQIGSELQKQFAILPGGRGINGNPVIIFPEF
PAFGDLPQDEIQNVLGYLTSVPSIAASGVGFILVIDRRQDRWAAVKATLHRIAGSFPGNL
HLVLVLRPSTFLQRTLSDVLFKKDEFKMKVVMLSSVTELHAYIDPGQLTREVGGTQEYCH
ESWISHRTAIEAFALMVKTTAQTLQAFGTELAETELPNDAEATTNLLHTHTQKKEKMKED
LQVALSQGGRLLDCIKEPLRTDPEYNMTHDEVENLATVQRLLGQLDETETAFDDFWERHC
TKLEQCLQLRYFELQFREVRAQLDATSERLSGFSEVSVSPAHADHVLRELSGHEGKACDV
LDRALSLAGEGDRLIENSHYAEDSIRPKCSELRSVCEEINSTLRSKKSLLLRAMELHHAL
EKALRWCEEGIFLLASQPVDRCQSQDGAEAALQELERYLDTAPLHTLADRSTVCCQYEAI
LTAQLMDQIERVFQKQSSVQEMFEKRRVSLKKLAAKQTRPVQPVAPRPEVKSPLSSPNPQ
RKERRYSADSAICKKGDSPIPNGGTRHASLSEEEENLAVLRRHVMNELLETERAYVEELL
CVLEGYAAEMDNPAMAHLIPNSLQNKKDILFGNMSEIYQFHKRTFLKELEAYTDCPELVG
RCFLERMKDLQIYEAYCQNKPRSESLWRQCSDCAFFQECQKKLEHKLGLDSYLLKPVQRI
TKYQLLLKELLKYSRGCEGCDDLQEALTSILGILKAVNDSMHLIAITGYEGNLSELGRLL
MQGSFSVWTEHKKGHAKVKDLARFKPMQRHLFLHEKALLFCKRREENGEGYEKAPSYSFK
HSLSMSAVGITENAKGDNKKFEIWCNSRDEVFIVQAPTTEIKSAWVNEIRKVLTQQLQAC
RDASQQKNSEPVSSSPTSNHSSGSPSPFRSNVQKNQKKPEEKKLESNTISEVNSLASPKH
RGRNEPVTSPPTDRSSVAKKRFTLQGFSNLKSPKGSSLSPEHSSKRHLVKSDPTPFGFKG
WNKASLSVEASEENSGYSSSEDPVNSDTEDEAAKKPAPGKYTVIADYEKAGAQEVSVKSG
DVVQLIREGEDGQWFVRNLRSSKEGWVPAANLLRLVSESKSSQSLSSSGTFPLCFPPSGV
QPV
Download sequence
Identical sequences H3BYD5
99883.ENSTNIP00000001001 ENSTNIP00000017540 ENSTNIP00000001001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]