SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001661 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001661
Domain Number 1 Region: 632-984
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.45e-70
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00026
Further Details:      
 
Domain Number 2 Region: 24-288
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.08e-66
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000168
Further Details:      
 
Domain Number 3 Region: 296-620
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.27e-64
Family Lipovitellin-phosvitin complex, superhelical domain 0.00000222
Further Details:      
 
Domain Number 4 Region: 1055-1221
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.9e-46
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001661   Gene: ENSTNIG00000001521   Transcript: ENSTNIT00000001411
Sequence length 1230
Comment pep:known_by_projection chromosome:TETRAODON8:1:17237030:17244325:-1 gene:ENSTNIG00000001521 transcript:ENSTNIT00000001411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLLCCLVALATCQNVRYDLGLNPKRVYEYKYEGRVNFGLGKPNVAESGARMTCKLKI
SGVSGQTFILQVSEVTFDEFNGLPGKANFVASPKLAQRLAAQFAKPFMFNYVGGHVSNIH
ASSGVSDTVVNIVRGILSFFHMTVKTTQRIYELEEVGIHGMCQSSYVTEMDRKTKDLSIT
QVVDVSNCREKAALYTGMAMAVLDNISKQKGESVVSTVRYVYWVKPTADGGLITKAHGLE
QQFFSPFNVKGGTFKMEAVKEMVLLGVTESLRAFTLGPMESKGSLVYKFVNPDASFPIIM
QNLNDPMPKAIELIKQLAEANKYNFNSTTTEDSIKVYQLLRVIPYEGLETMWKQFAGNRE
QRNWFLDLVVEVNDARIIKFLENRFHTGDVSASEAVQILLLAINHLQPVPELVEMAKTFL
TLPFSKSSVYLWQTVMLTYGSLVYRNCAYYTPCPISTVQPLINIAEESLRTRNENEMVTV
LKALGNAGHPGSIKTIMRFLPGVAPTVELPPSVLSAAVQSLRLIAARDPHSVRDITLNLF
MQKTLAAEIRMLAFLILFETKPPMALVTTVTSHLLEEKDFNVVSIAYSYLKSLARSTTPD
NLFLSSACNVAVKILAPKFGHLTIFHLFVTNLDDFLIGTAAEIFMLRSANVFPSEIIMKS
KFFFIGRILELLELGVQAEGIKELFRSAAPESFSLTDFGAIFNMLRNWEALPSDKPAFTI
YSRISGQEWFFLSINKDSIRNMVQAVQPSAGKESWLWDLIHSLQERSSWNRAKPFLTLET
RYFQATSLGFPLEISKYYQSINAINVNAKAAVNPPLTDTLRQLLTSEVSLESDGSLGLTK
DAWMSYGINTELFQCGSEVKSKTALSLPWKVAAKINVKEKKTNLKFFTSGCLPFTHSSNV
YAVNRNIEDTDKMTPLFPPSLNPYSKMLDANYLHWSNEDCAVSNVYGFGLCADSELQRQY
YHEEYPLYYFLGFTHLAIKAVPASHYKVQAVKPVEKIHLEFNANTSEVLRSTSQLLETLR
SLSKVCHGSSNSNRKPLNCLPPGSQNMAAAPQALFGFKALATSGGQRPEGYEGALYYNPE
AGVPNSQLTLSQVGENTNWSMCMDSTMMAPSETKANIRWGAECQTYKMSVRAETAHLPAS
KPALKASLNWGEIPESMAEFGRRIGRYIPGMAFLYGFSQQNENNAKQEVSASMVVTSADS
VEVKVKFPEYTVSRQAIPFPMLPASFYTTT
Download sequence
Identical sequences H3C095
ENSTNIP00000001661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]