SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003063 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003063
Domain Number 1 Region: 622-1033
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.24e-121
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000604
Further Details:      
 
Domain Number 2 Region: 286-619
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.83e-82
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000192
Further Details:      
 
Domain Number 3 Region: 24-285
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.65e-76
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000189
Further Details:      
 
Domain Number 4 Region: 1186-1354
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.49e-57
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003063   Gene: ENSTNIG00000000613   Transcript: ENSTNIT00000000928
Sequence length 1654
Comment pep:known_by_projection chromosome:TETRAODON8:1:16625534:16633601:-1 gene:ENSTNIG00000000613 transcript:ENSTNIT00000000928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVTVLALALALVAVGSQATAPYFASDNTYVYSYEARILGGLPEEGLARAGLKIRCKVLI
RKANDALFNLSEPEILEYSDIWPKDAFSPATKLTTALATQLSTPIKFEYANGLVGKVYAP
AGVSATVVNIHRGILNVLQINIKKNQNVYDLQEPGSQGVCKTHYIVNEDRKAERVLLIKT
RDLSHCNVYKVVGLAYTHRCPECEATGKSLNGASTFSYVLKPTAQGSLIMMATSEELIQF
SPFNILKGAAQMESRQILKFLNIVKTPLEPVRADYVPRGSLQYEFGSELLQMPIQLLRIT
NAEAQIVEILNHLVNFNVAKVHEDAPLKFIELIQVLRVVQFKTIEELWERFKAKPDYRNW
ILHAIPAIGSHTAVRLLKEKFIAGELTIPEAAQALIASVHMVTADIEVIKLFEGLSVHAM
IRENPVLREVVMLGYGTLVAKYCAENPSCPAELVRPIHEIVIQALDKVAAEELILGVKVL
GNAGHPGSLKTLMKLLPSFGASGTRVPHRVHVEAALALRNIAKKEPRMVQNIAVQLFMDK
TLHAELRIAATIVLFETKLPMGLVVSLAKAVLKEENMQVASFVYSYMKAMTKNTTPDYAS
VAVACNVAVKLLSPRFNRLSHRYSRALYLDAYYSPWMMGAAASAFYINEAATVLPKTIVA
KARTYLAGAFADVIEVGVRTEGVQEALLKMNDQNTQRIDKIKQIVQALAGWRASPSSQPL
GSLYVKLFGQEVAFANIDKAVVDQVIEFARGPAISSYGRMAWEALLSGFKMHLVKPMLVA
EIRRIFPTAAGLPMELSFYTAGVAAATVECQGTVTPPLPKDFHASQLLNSEISMRAAIAP
SASLHTYAVMGINTAFIQAAVLSRAKVYTVLPAKVQAKLNMVKGNFKFDLLPVQAVDKIA
SAYVDTYAVARNVEDISAAKLTPILPDQASLELKKHSSWMTSSSSSSSRSSETHSSSQQV
VDRSEILKGYESKLCKEFETYGIKVCADIETHNAAYIRNSLLYAIIGRHAAWIQLARASG
PSIENIEIEIQVGDKAAEKVLKTINLSEEEEVLEDKTVLMKLQKILIPGLKNSSSSSSSS
SRSSSSSSASKPSSSSSSHHKSKMVDVNSPIFKKSKKSSSSSSRSSVLSRSSSSKVTKKA
GSFELKFAKNHAHQHDVTSRRKQGVSSASSFEAIYNKARYLANIVRPYVTILIRAVRSDH
KPQGYQITAYFNKQDRRVQIVLANLAESENWRMCADAVLLSDHKMTASLHWGKNCKQYRT
VLTAETGSVAQEPAIRLKMSWGNIPQYMKHSARQFFYFVMHLPYDIGVTAVKAKNAPKEI
TVTVAVASENSLSFQMMTPERTFYKRDIPLPFYLPVGETAAEIQLYPNNWLDKFSYILSK
SITAECTVLKDKIITFNNWSIKPELPHSCAQVLVQDCSQELKFLVLLKRDNTQYQNQINI
KIADLDIDMYNKNNAVELRVNGMPVQLTTQTYQHPTGQIHIRQRGEGIALHAPFYGLQEI
YFDLSALKVQVVDWMKGQTCGLCGKADGEMRQEFRMPNGRVTKSAVSYAHSWVQPGRSCR
DSTGCLMKHESVKLDKQIFIVGQESKCYSVEPVFRCLPGCMPVRTAQVKIGYHCVPADTS
LNQSEIQNSMFGKSVDVRETAEAHLACRCSVQCP
Download sequence
Identical sequences H3C494
ENSTNIP00000003063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]