SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004671 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004671
Domain Number 1 Region: 419-820
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-134
Family Ankyrin repeat 0.0000000000212
Further Details:      
 
Domain Number 2 Region: 182-437
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.42e-77
Family Ankyrin repeat 0.00000316
Further Details:      
 
Domain Number 3 Region: 26-182
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.16e-41
Family Ankyrin repeat 0.0000701
Further Details:      
 
Domain Number 4 Region: 1427-1508
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-17
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004671   Gene: ENSTNIG00000005321   Transcript: ENSTNIT00000004814
Sequence length 1621
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:77057185:77073182:-1 gene:ENSTNIG00000005321 transcript:ENSTNIT00000004814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSNEERRSAARRLAAKTSGKMQADASTSFLRAARSGNLEKALDHIRNGIDINTANQNGL
NGLHLASKEGHVKMVLELLHAGIELEATTKKGNTALHIAALAGQEKVVAELINYGANVNA
QSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINY
GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENMSVAQLLL
NRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVR
IIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDGVRQLLQFNADIDDITLDHLTPLHVAA
HCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSLDLLLKHSASLEAVTESGLT
PLHVAAFMGHLNIVKTLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNTAQVDAK
AKDDQTPLHCAARMGHKELVKLLLDHRANPDSATTAGHTPLHICAREGHMHIIRILLDAG
AQQTRMTKKGFTSLHVASKYGQVGVAELLLDRGANANAAGKNGLTPLHVAVHHNNLDVVK
LLVSKGGSAHSTARNGYTPLHIAAKQNQMEVASCLLQSGATPNAESLQGITPLHLAAQEG
RPDIAALLLSKQANVNVGNKNGLTPLHLVAQEGHVGIADMLVKQGASIYAATRMGYTPLH
VACHYGNIKMVKFLLQQQAHVNSKTRMGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITSK
NGTSPLGIAKRLGYISVIDVLKLVTEESVSAVTTEKHWMSFPETVDEILDVSEDEGDELL
GMDGGRYLKLDDFKDQDEDFLSPKKTLRDFEGGVGTTFNRFLSHRPYSPAIPRIPCVSPE
TVLLDQHTPVPLPKEYDEDSLIPSSPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRG
SRHHGLRIIIPPRTCTAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGP
VIVEIPHFASLGRGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGMDEDLESLEELEK
KRIRRILSTDFPLYFAVVSRIQQESDLIGPEGGRLSSRLVPHVEAIFPEAAVTKRVRLGL
QAQPIPDELLTRQLGNQATFSPVVTIEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTT
SLRLLCSVIGGTAPAQWEDITGTTKLMYASNCANFTTNVSARFWLADCPRTAEAVAFANL
LHRELMAVPYMAKFVVFAKMNEAREGRLRCYCMTDDKMDKTLELHENFAEVARSRDIELM
EGMPLHLECSGNLVPVRKATQQPRSFSFQAFRDNRLPVAVKVRDANKEASGFLSFLRKCT
KYEDTQHVLCNLNIAMPPCIKVVGSEERKRTLTPLALTVVNAMERAELKISLISEQLGLS
WAAELARELHFGVDDINRIRVENPNSLLDQSAALLGLWAGREGRRAKMESLCTALKNIDR
ADIVAALEAPPPTAGSSDGTSHWSSQASSLACPPSGFGLVQDELLSPASMQYSLPSPLGA
EPYWQEVSSLECAPMATTEEDTLMEMSELQVWPAGLSPSLVTVEDSSLEGSSRADDSEGA
T
Download sequence
Identical sequences H3C8U9
ENSTNIP00000004671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]