SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005946 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005946
Domain Number 1 Region: 640-896
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-55
Family YWTD domain 0.00000417
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-53
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 339-577
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-52
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 944-1203
Classification Level Classification E-value
Superfamily YWTD domain 1.2e-33
Family YWTD domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1333-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 899-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1255-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000118
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000484
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 596-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000189
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 293-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000761
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 1212-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005946   Gene: ENSTNIG00000003359   Transcript: ENSTNIT00000006094
Sequence length 1623
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:58584115:58594665:-1 gene:ENSTNIG00000003359 transcript:ENSTNIT00000006094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVALRTLLLWSFCCLVRGVPLLLYANRRDLRLVDAAQEKANATVVVGGLEDAAAVDYVY
SQGLIYWSDVSEEAIKRTVFNQSGAHSVQTVIPGLASPDGLACDWLGSKLYWTDSETNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIIDT
DIYWPNGLTLDYQQQKLYWADAKHSFIHRCDLDGSSREVVVKDDLPHPFALTLYEDTLFW
TDWNTHSISTCSKHTGGEQRVVHANIFSPMDIHVFSGKRQNTRGGASAVVSSPCRVDNGG
CSHLCLLSPLEPFYQCACPTGVQLLADGKSCRDGATQVLLLARRADLRRISLDTPDFTDI
VLQVDDIRHAIAIDYDPVDGYIYWTDDVVKAIRRSRLDGSDAQFVVTSQVNHPDGIAVDW
IARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIE
RADLDGMERLVMVNTSLGWPNGLALDYQERKIYWGDAKTDKIEVMDMDGTGRRVLVEDKL
PHIFGFTLLGDFIYWTDWQRRSIERVHKHTAEREFIIDQLPDLMGLKAANVHQASGFNPC
GDSNGGCSHLCLFKPRGVQCGCPIGLELIADMKTCIVPEAFLLFSRHTDIRRISLETNNN
NNVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMA
VDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKP
KIDRAAMDGSGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQEREVIADD
LPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWN
ACTSTNGHCSHLCLAVPVSSFVCGCPAHFSLNDDNKTCSAPTSFLLFSQKTAINRMVIDE
QQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSVTVVSGLMGGPS
QGIQLYDLSIDIYSRFIYWTSEVTNAINVTRTDGSRVGVVLRGEQDKPRAIVVNPERGYM
YFTNLLERSPKIERAALDGTEREVLFFSGLGKPVALAIDNELGRLFWRWTRTCRRTSTSS
RANRIVIADSNILQPVGLTVFGSHLYWIDKQQQMIERIDKTTREGRTKVQARVPYLSDIH
AVNELDVREYSKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQNELSCGDPPTCSPE
QFSCLSGEVDCIPRAWRCDGFAECDDSSDEEDCPVCSKAEFQCDSRQCIDLGLRCNGEVN
CQDRSDENKCEVRCPPDQFTCTNGQCIGKHKKCDHNMDCTDNSDEIGCYPTEEPPPPPNS
TIGSIVGVVMTLFVVGAAYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHQGSL
TSSLPGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPA
TVRSQYTLEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPVKSS
AGVKGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCT
DSS
Download sequence
Identical sequences H3CCH4
ENSTNIP00000005946 99883.ENSTNIP00000005946 ENSTNIP00000005946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]