SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008004 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008004
Domain Number 1 Region: 419-820
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.98e-134
Family Ankyrin repeat 0.0000000000212
Further Details:      
 
Domain Number 2 Region: 182-437
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.12e-77
Family Ankyrin repeat 0.00000316
Further Details:      
 
Domain Number 3 Region: 30-262
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.98e-61
Family Ankyrin repeat 0.000024
Further Details:      
 
Domain Number 4 Region: 1460-1541
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-17
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008004   Gene: ENSTNIG00000005321   Transcript: ENSTNIT00000008166
Sequence length 1654
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:77057185:77073182:-1 gene:ENSTNIG00000005321 transcript:ENSTNIT00000008166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSNEERRSAARRLAAKTSGKMQADASTSFLRAARSGNLEKALDHIRNGIDINTANQNGL
NGLHLASKEGHVKMVLELLHAGIELEATTKKGNTALHIAALAGQEKVVAELINYGANVNA
QSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINY
GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENMSVAQLLL
NRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVR
IIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDGVRQLLQFNADIDDITLDHLTPLHVAA
HCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSLDLLLKHSASLEAVTESGLT
PLHVAAFMGHLNIVKTLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNTAQVDAK
AKDDQTPLHCAARMGHKELVKLLLDHRANPDSATTAGHTPLHICAREGHMHIIRILLDAG
AQQTRMTKKGFTSLHVASKYGQVGVAELLLDRGANANAAGKNGLTPLHVAVHHNNLDVVK
LLVSKGGSAHSTARNGYTPLHIAAKQNQMEVASCLLQSGATPNAESLQGITPLHLAAQEG
RPDIAALLLSKQANVNVGNKNGLTPLHLVAQEGHVGIADMLVKQGASIYAATRMGYTPLH
VACHYGNIKMVKFLLQQQAHVNSKTRMGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITSK
NGTSPLGIAKRLGYISVIDVLKLVTEESVSAVTTEKHWMSFPETVDEILDVSEDEGRPSL
FLSRLSVTNRLPLLSTGDELLGMDGGRYLKLDDFKDQDEDFLSPKKTLRDFEGGVGTTFN
RFLSHRPYSPAIPRIPCVSPETVLLDQHTPVPLPKEYDEDSLIPSSPATETSDNVSPVAS
PIHTGFLVSFMVDARGGSMRGSRHHGLRIIIPPRTCTAPTRITCRLVKPQKLTTPPPLVE
GEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSENGSVWKEHRNRYGDE
VLETILNGMDEDLESLEELEKKRIRRILSTDFPLYFAVVSRIQQESDLIGPEGGRLSSRL
VPHVEAIFPEAAVTKRVRLGLQAQPIPDELLTRQLGNQATFSPVVTIEPRRRKFHRPIGL
RIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYASNCANFTTNV
SARFWLADCPRTAEAVAFANLLHRELMAVPYMAKFVVFAKMNEAREGRLRCYCMTDDKMD
KTLELHENFAEVARSRDIELMEGMPLHLECSGNLVPVRKATQQPRSFSFQAFRDNRLPVA
VKVRDANKEASGFLSFLRKCTKYEDTQHVLCNLNIAMPPCIKVVGSEERKRTLTPLALRE
RYSVLNEPGLAVVNAMERAELKISLISEQLGLSWAAELARELHFGVDDINRIRVENPNSL
LDQSAALLGLWAGREGRRAKMESLCTALKNIDRADIVAALEAPPPTAGSSDGTSHWSSQA
SSLACPPSGFGLVQDELLSPASMQYSLPSPLGAEPYWQEVSSLECAPMATTEEDTLMEMS
ELQVWPAGLSPSLVTVEDSSLEGSSRADDSEGAT
Download sequence
Identical sequences H3CIC6
ENSTNIP00000008004 ENSTNIP00000004671 99883.ENSTNIP00000008004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]