SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008189 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008189
Domain Number 1 Region: 224-572
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 2.04e-36
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.027
Further Details:      
 
Domain Number 2 Region: 4-207
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 3.01e-20
Family Lipovitellin-phosvitin complex, superhelical domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008189   Gene: ENSTNIG00000005494   Transcript: ENSTNIT00000008355
Sequence length 1698
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:32675681:32687627:1 gene:ENSTNIG00000005494 transcript:ENSTNIT00000008355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALVYGLGLQANPDAARVQDMLSMAQYKQSKAIMYALANTVKKYYKGEVTTVLKDVAKFIK
SLLNDCLREGHEADEMTFLILRVLVVGVMGPALQAASPSLISSILQCVKKTDIPLSNQKA
AIHAFRLMDITNEVASNVLLEVFRDAKSPVEKRIAAYLILMKNSERSPVRDILKSLHRTS
DKQLKSFVVSHLMNVHKSDQKIKEQFGQDIILALRDQPPSNDKSQNFRADYSFGSIQSDV
IFDDMNILPKEVTLKTTLNVFDGNFDMFEVGVEGSGFEPKIAALFGKNGLFPDSASKFFY
WAGEKAPFLRGFLERIGPGAGNTKTQVPQDFLKDLMKSVQKFLRGLQLSPAPEIIAFLRL
LGNEVGYMKASELRQTVETLFMHYHALIPSLTAQTSSTENDVFAHYIFMEKTFSIATAAG
FPQCSFSGLLSPGAKGGLKYSFSDQRGQISSHIPSSTGFSILPLWYLPSSLYVARATMQX
NQIRLSISAPRSSTQLLSVSHRVSLVSSSQTTTVPSIEECVESSECQPLFSGLRFCTVVC
HSNFTAMENVPFYPLTGKSRFAFEVQPSGNVSEYTATITDERTKETRKDIFRVKTLTLKA
EAGDYSKEARVSLKYSQSKKVFVAEVLIPHYDVEAGMKITVTDSDSNVNGMFGTSIDVTN
RNSPVMNLIAQTRFGKDTMLHLQTVFPSLKSNASFTSNLRTDEDMLMDVKTIISLPETHY
QQKVSFKYDSDKLEMQLKSDLRSGIKKLMPNVESHRRRLQDLMDQVLDQQVTMTDMKYRH
IVSKGIEAANIWLNKLIVRVPVLANLRRKRSISDLTLPALPENLFLQWNSFFRYQFNKDK
MTILFYLPLGGQKSEDLNVPLTLSIPLNGLYGPDIKYQLPSFTIPPFFLNLPLLGLAEAH
TKISSNLYDWETSLYLGNKTVDVPTYIAEFKIMGHSPVKALSYKFQGTGQMSGRADDDLK
YQLDGFFSHSLFDTSFSLSQMSRVTDKLRTSVDYSIEASSLAGLQASAYYTARSESTLHS
DDVSGDGTLEASFQLGSSHINSSYAHSYKLRPVEQEGRGECTLSLRSSLIQIHNHIHAVY
VNSELNIVSKTSSNNGFLAQTVELRYKDAELTLRSNAAARVVSIPLNNRVELAVSTHAAS
LTVESQAENDKKRLYFILTGTVDSNWLKIMTEGALMLGAGCRGLHKASVMANRTDLSTNV
TNSIQCNPVTVELVLSGDTGSSEVTLEFTTTAVTAVSRGECTIRGQITPQEASLYGVLTG
QAYDATTRNDMNILLNRRTLIFSSNTMGAMKELTTEHSHSLALTLWTLTLRSQTKNFIQR
DIYYEQTAKVDAKPFLLSFALKNDLKIHDVILSHDGRMKLEPLKVDLRGSTKGANGRGLS
ITHVYDLNYENNYGTVKYRLAGTAMNAQLHHKCHLAFAGFASGANCKTQIDSEFLHFDGA
VCAVAVPFRVLVDAFVRSDAGMNLQGNHTGQLDSKLLFKAEPFTLAYAHESRLKTLHVLQ
SGDISSHINHTFDGLLTPTEQFLTWEVNSKLNNAAYSQDASIYNNPMKSGFNFSYLLMTD
VLNKYIKNNFSHRGNEEISLALGLTYEKSRSCRVVESPSFRSFPCNLKQLKDTIVQALEY
LKHSTNKLNIGQIIVDLQVKLKQLPMQVRHFIQESFSEQKMNRVKAKLDSLMKDFTVTMD
DLEIGMSKFWKMLENTLI
Download sequence
Identical sequences H3CIW1
99883.ENSTNIP00000008189 ENSTNIP00000008189 ENSTNIP00000008189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]