SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013434 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013434
Domain Number 1 Region: 260-335
Classification Level Classification E-value
Superfamily TAFH domain-like 1.57e-29
Family TAFH domain-like 0.0000714
Further Details:      
 
Domain Number 2 Region: 689-724
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000264
Family TBP-associated factors, TAFs 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013434   Gene: ENSTNIG00000010523   Transcript: ENSTNIT00000013628
Sequence length 826
Comment pep:novel chromosome:TETRAODON8:Un_random:33416924:33460457:1 gene:ENSTNIG00000010523 transcript:ENSTNIT00000013628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPASVGTTTPGCSPPPASTTSAAGVNATSSGSVSHRAPVTTLTESAVSTLATTQARISTT
SERGSKVVPGTATVATAAPAQPRPGLSAPQRIVAPQLIVRPPQQQTTIQLPPGFTIPPGM
VLVRTELGQLVMVPQQALAQVQAQAQAQAQNNISPRPATPTTGASYRVATPQSTSTSMFD
RQYNNNAKKIGVQCSTLYFTKAQPLCRPVSLPTTVSFTVTVWKLLNTGPALRPLSLPVKD
TPKMKSIIKIRSSCFFTAMIVNEMQENVKKCKNFLATLIKLASHNSPSPETSKNVKALVQ
DLLDAKIEPEEFTSRLQAELKSSPQPYLVPFLKTKTRKAFRECRPLTNSLFVDILWVTMK
KLFFATLFTLLKLMSMIIAAVWTKHVINNSVLNGQTLPTLLQIIQQSLTQPPQQGVKTAP
GGTPTAMVTGPAVRIHHPNSISTTGGANVLPTGTLAGHSGAVTVSNISLHYISPRIILSS
PSLSALPQLLTVAGNVGAAVHVQNMPVVHLSLTHFAGPVAGTKEGIKTAGAVGGHVRMPV
VITQSVRAQGMESVRKKSFSCKYVRSISHISTLYLRCCLLTLIHKHSSHRSSQISPQHQG
IMLPKERCMAVQISGNQKNKLNDPGGGSFRRVAAFLSISHMGTAGYSLSLGCECLFAFNS
YIMSQLIEKITDELNLILGISKGCLTDMTAKRFGVTEVPMEAVTFISHAAQSRLRTVIEK
VSTVAQHRLDSCKDDEYYEQTADVRSQLRFFEQLERIEKQRKDEQEREILLKAAKSRSRQ
EDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKADS
Download sequence
Identical sequences H3CYU9
ENSTNIP00000013434 99883.ENSTNIP00000013434 ENSTNIP00000013434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]