SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015112 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015112
Domain Number 1 Region: 1304-1402
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000765
Further Details:      
 
Domain Number 2 Region: 655-830
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000386
Family Tropomyosin 0.0055
Further Details:      
 
Domain Number 3 Region: 784-1016
Classification Level Classification E-value
Superfamily Tropomyosin 0.000085
Family Tropomyosin 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000015112
Domain Number - Region: 438-639
Classification Level Classification E-value
Superfamily Tropomyosin 0.000556
Family Tropomyosin 0.0055
Further Details:      
 
Domain Number - Region: 1232-1335
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00115
Family Myosin rod fragments 0.0024
Further Details:      
 
Domain Number - Region: 973-1149
Classification Level Classification E-value
Superfamily Tropomyosin 0.00379
Family Tropomyosin 0.0023
Further Details:      
 
Domain Number - Region: 216-431
Classification Level Classification E-value
Superfamily Tropomyosin 0.00523
Family Tropomyosin 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015112   Gene: ENSTNIG00000012148   Transcript: ENSTNIT00000015316
Sequence length 1404
Comment pep:known_by_projection chromosome:TETRAODON8:13:5164652:5175187:1 gene:ENSTNIG00000012148 transcript:ENSTNIT00000015316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRILQMTPGKGGSQNAESEPPSAELNHDQTSEGFICPQCMKSHNSAEELFKHYDLFHD
TGELPAHVAPTRQREDLTMLRQEVQDLHASLKEERWFSGELKKELDKVQGHLKQNIEANS
CCNWFNLSLYLQTLERKLNEAETEKFNIKQMKDLFEQKAAQLATEIVDLKSRYDEEKSLR
DAADHKLANLNEQLQREKQEKERLLTELLQRPGVEDVEVLQKELVQVQTLMDSMTREREE
ESERLKNHYEQLQANYTNSEMTIAQLKAELEKGPQEVAVYTKEIHELRSSLNSLQQQSQS
LSEKLEQKEKDYLQLEEMLAKEKGSKKKAQDGLKERDQEVQELQARLAGAETSLQKAQAE
LQERTEEVSKLRSEMGELEVKHAELKVERKQLEQLREEKESHGAQQQTEIGQLHAKLLET
ERQLGEVEGRLKEQRQLSGEKLKDREQQAADLQLKLSRTEEQLKESATKNTDLQHQLEKA
KQQHQELQVLQQNTNGKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKDIVSQLEAER
DDLCAKIQAGEGETAVLNQLKDKNQALQGQVTQLTDKLKNQSESNKQAQDNLHKQVQEQK
TLLRSAQDRAHTMETTVTELTAQLTDSKEKVSQLDAQLKAKTEMLLSAEAAKAAQKANME
NSLETAQHALQDKQQELNKVQKKIEEQTQSLKEKREQCTQLETNVKEYKDKLLASEQRTE
QLQSLNKRLESQLGELQTAHEQVQQQVQKLQKESTEMKQKAKELQHSLETEKAGLVSELT
LMEKIKTKTAALTEVQQQLKGCEQDRATLTTNLDKANQEQIHLNSKLQNLLADLQKAQQE
KEAHKKEIGSLQENLGKTKKALKESQNVLDAERKSHQSAVEERDKSNQKARQELLKKNEA
LTKTMNESKDQLEQMREAEKSLKVQLTSVEQQQVKAQEALKQKQNQLEKLQAQLQTVEGS
LEVETKKLKGQIAELQESGVKKAEEEKQLRAQVAGLSEELASEKRRTTEVQKALEQSQES
QSKLQSDLYGKETEVSALHQDLRACEEKLKLAQEELAGNQTHQTGLEAQIQELQVSRGSL
EEELGKLEHKLQQREQTLKDSEKHQTQVKEELKREKSKAEELNKLKNDLENNSSRLAADL
KALKEKSDKELGNLQEAKLLLIQQKLELQTQVEAAQGDLEQERKEHQSTKDGSLRRKEQL
LAQIKDVQDQLSSEKKAREEQAKRGEEAEARTSAQVTALNENVATLKREWQGSQRRVGEL
EKQTDDLRGEIAVLEATVQNNQDERRALLERCVKGEGEIEKLQAKVVELRRKLEDTTAAM
QELGRENQSLQIKQSQSLTRKWAEDHEVQSCMGCGKGFSVTVRKHHCRHCGNIFCAECSS
RNALTPSSKKPVRVCETCFEELQG
Download sequence
Identical sequences H3D3M4
ENSTNIP00000015112 ENSTNIP00000015112 99883.ENSTNIP00000015112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]