SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000015580 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000015580
Domain Number 1 Region: 253-347
Classification Level Classification E-value
Superfamily TAFH domain-like 2.75e-33
Family TAFH domain-like 0.00000835
Further Details:      
 
Domain Number 2 Region: 534-583
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000628
Family TBP-associated factors, TAFs 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000015580   Gene: ENSTNIG00000012608   Transcript: ENSTNIT00000015787
Sequence length 748
Comment pep:known_by_projection chromosome:TETRAODON8:9:7158255:7163389:1 gene:ENSTNIG00000012608 transcript:ENSTNIT00000015787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPSAAAASVTSIIRSASHNTATSSQQTVPTVTLVRPPGSTPSSILPASLAVSVSSASGSI
PNKADGPKPIIQTVASAATATITAPSTIAISTGGGVRALGPPMVAPRVTQTQQTTTNVQN
IQLPPGMVLVRSESGQLLMFQQQNLAQMKAQSQSQSAITPRLTVPASTPPVQVTSLQAPA
ASLLTRAVTPTTIIKQVSTVHTTGTTTATLQRPPVLQNTIMLGGTVTPPGQPLGTTTTVQ
PLTATGTSVTPTAFTAETLENVKKCRNFLSTLIKLTSNGKQSSETTANVKELIKKLLEAK
IEPEDFTSRLYQELSSSPQPYLVPFLKRSLPALRQMTPDSEAFIQQSLLPQISTPAAAAS
TALAAVVLRPPLSTAASSSSTSTALTKTTVISLPQTPHSKPTLFWVQLVPQQKGTITRPQ
MMLAQSPVMTLQGPTHSRVIVGQLQTGQKGTLICVSAVKQTVAPSTKGVQVVTQSLLHAA
QKSKETAGGTFRDDDDINDVASMAGVNLTEESANILATNSELVGTVTRSCKDEMFLSPSL
LSRRALEIGKKFGVSELGADVISYISHATQNRLLNLLEKVSHVAQLKNHNLKEDGRHEQV
CDVRAQLRFFEQLDRLKAAKVTKSSRRRPLPAGQSRSRQEDPEQLRLKQKAKEMQQQELA
QIRHREANLTALAAIGPRKKRKMDSLVRGAGAEGSGLCPSQSGGSSGPGSRQFMRQRITR
VNLRDLLFCLENERGTNRSQLLYKGFLK
Download sequence
Identical sequences H3D4Z1
ENSTNIP00000015580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]