SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000016952 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000016952
Domain Number 1 Region: 5-215
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.9e-62
Family D-ribulose-5-phosphate 3-epimerase 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000016952   Gene: ENSTNIG00000013947   Transcript: ENSTNIT00000017166
Sequence length 226
Comment pep:known_by_projection chromosome:TETRAODON8:2:12377974:12380336:1 gene:ENSTNIG00000013947 transcript:ENSTNIT00000017166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYNAKIGPSILSSDLSCLGSECVRMMECGADYLHLDVMDGHFVPNITFGHPMVECLRKS
VGQDPFFDMHMMVSRPEQWVKPMAAAGANQYTFHLEATTNPGNLIKDIKESGMKVGLAIK
PGTTEELAPWANHIDMALVMTVEGFGGQKFMEDMMPKVSWLRSQFPSLDIEVDGGVGPDT
VHKCAEAGANMIVSGSAVIGSDDPRSVIALLRTAVAEAIQKRSLDR
Download sequence
Identical sequences H3D8W1
ENSTNIP00000016952 99883.ENSTNIP00000016952 ENSTNIP00000016952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]