SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000018931 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000018931
Domain Number 1 Region: 399-804
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.86e-135
Family Ankyrin repeat 0.00000000000977
Further Details:      
 
Domain Number 2 Region: 162-425
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-79
Family Ankyrin repeat 0.00000262
Further Details:      
 
Domain Number 3 Region: 10-162
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-40
Family Ankyrin repeat 0.0000767
Further Details:      
 
Domain Number 4 Region: 1406-1489
Classification Level Classification E-value
Superfamily DEATH domain 2.76e-21
Family DEATH domain, DD 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000018931   Gene: ENSTNIG00000015846   Transcript: ENSTNIT00000019159
Sequence length 1906
Comment pep:known_by_projection chromosome:TETRAODON8:12:6727898:6748843:-1 gene:ENSTNIG00000015846 transcript:ENSTNIT00000019159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLH
NGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEV
VKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDT
RTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIA
SRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRIIEILLDHGAPIQAKTKNGL
SPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGGKPNS
RALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQK
GASPSASNVAQKVETPLHMASRAGHYEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKE
LVKLLLDHKANPNATTTAGQTPLHIAAREGHVQTVRILLDMEAQQAKMTKKGFTPLHVAS
KYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYT
ALHIASKQNQVEVANSLLQYGASANAESLQGVTPLHLASQEGRPDMVSLLISKQANVNLG
NKSGLTPLHLVAQEGHVAIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQ
ANVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGAQPNETTANGTSALAIAKRLGYISVID
VLKLVTEETVSMTTTEKHRMSFPETVDEILDVSEDEGEELLGTEGARYMKMDDLKDHDDD
FLSPKKSLANYSPAIPRIPRVSPETVVLKEQDIDQHTPLPLPKEYDEDSLIPSSPATETS
DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKL
TCPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFASLSHGDRELVVLRSENGSVWKE
HRNRYGDEVLETILNGMDEDLESQEELGKKRIRRIISTDFPLYFAVVSRVQQESDLIGPE
GGSLASTLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVVTVEPRRR
KFHRPIGLRIPLPPSWRESPRDSGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLLYAKD
CASFTTNVSARFWLADCPRTAEAVTFANLLYRELSAVPYMAKFVVFAKMNEMREGRLRCY
CMTDDKMDKTLEQHENFSEVARSRDIEVMEGMPLHLECSGNLVPVRKATQQPRCFSFQAF
RDNRLPVTVKVRDSSKEPAALLSFLRKSTKYEDSQHVLCNLNITMPPCIKIIGGEDRRRT
LTPLALRERYSALNEPAMASMSAMERTELKMAVIAEQLGLSWAELARELQLSVDDINKIR
VENPNSLLEQSSALLNLWATREGKRAKMESLYMALKSIDRMDIVNVLEGQPPQPARQGPR
DPSRRPHDREHLSPGVTNGYGLAQEELLSPASMQYSLPSPLGSEPYWQEVSSLDCAPIAT
TEEDTLMEMSDVQVWPSGNSPSLVPVEDSSLECSNADDSEGLLGLPYGSLGRPASQASAA
SGGGGLLSGSIELPEDDSEMGVDSLSTATPASLGGTIAGMNLNGLNNGQGSEMGSAEGLS
LVAGQQRVYARLSESPALGCVADRNIDRSGNGGNGGGSLLAYLQEQTGQGWMAEQTQAWP
GSQNKARQAMDTMMSSVCNALDGEQIHISQEALIQPHPGQTGANWGKLGQTGAVFKAHWS
HDQSGRGEEVEDLPGEHVSEEQFMDEHGNIVTKKIVRKVVRRGKGAGEDGVQEMEGSLQD
ANELELDPEQYMSYAVLGRDGSKPDSVDVKKGAQIVKCATLRRVKQ
Download sequence
Identical sequences H3DEI8
99883.ENSTNIP00000018931 ENSTNIP00000018931 ENSTNIP00000018931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]