SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000019946 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000019946
Domain Number 1 Region: 6-176
Classification Level Classification E-value
Superfamily E set domains 3.18e-67
Family Arrestin/Vps26-like 0.00000139
Further Details:      
 
Domain Number 2 Region: 182-355
Classification Level Classification E-value
Superfamily E set domains 6.06e-55
Family Arrestin/Vps26-like 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000019946   Gene: ENSTNIG00000016832   Transcript: ENSTNIT00000020176
Sequence length 356
Comment pep:known_by_projection chromosome:TETRAODON8:1:8714985:8717097:-1 gene:ENSTNIG00000016832 transcript:ENSTNIT00000020176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSKFLRVFKKTNGNGNITLYLGKRDFVDHVDSVEVVEGAVKVDPSGLNGRKVYVYLACAF
RYGSEDLDVMGLSFRRDIWIQRVQVYPPTGDNTAKTPMQEFLLGKIGEQGYAFSFQMPTD
LPCSVSLQPGPNDSGKACGVDFEVKAYLANAPHNVDEVIEKKDTCRLMIRKIQFAPATNK
SGPKADITKQFIMSDKPVHLEASLEKEIYYHGQPITVNVKIHNESSKVVKKIKISVEQLT
NVVLYSSDTYTKTVCLEEFGETVNSNSTLEKSFQLTPLLSNNKEKRGLSVNGRLKDGDTH
LASTTLSQGEKEMQGIIVSYKVKVNLMVSGGGLLGGLTGSDVTVELPLTLMSPKPA
Download sequence
Identical sequences H3DHF2
ENSTNIP00000019946 99883.ENSTNIP00000019946 ENSTNIP00000019946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]