SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020796 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020796
Domain Number 1 Region: 2-548
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 7.33e-80
Family Acetyl-CoA synthetase-like 0.0000238
Further Details:      
 
Domain Number 2 Region: 682-1028
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.23e-44
Family Quinoprotein alcohol dehydrogenase-like 0.0044
Further Details:      
 
Domain Number 3 Region: 534-584
Classification Level Classification E-value
Superfamily ACP-like 0.0000222
Family Peptidyl carrier domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020796   Gene: ENSTNIG00000017647   Transcript: ENSTNIT00000021029
Sequence length 1034
Comment pep:known_by_projection chromosome:TETRAODON8:1:11947275:11952285:-1 gene:ENSTNIG00000017647 transcript:ENSTNIT00000021029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTLQGLVVAAASGHSDRVAVTYDDGSPVSLLYSDLLQLSGELSGILRTSCSPNNGAIGLY
CSDDLFVPVWVLGILQSPAAYVPLDPETPGLLSARVLSQCGLQYCAVKTDLLQIFQPFML
QMNSTANNLLLFHIIISLSFLAPLQRFQASLVDHVSVEDGTKTLEEDGAGGLAYVLHTSG
TTGLPKIVRVPHKCILPNILHLRSLFQMTADDVVFLASPLTFDPSVVDMFLALSSGAQLL
VVPSVLKQTPGRLARRLFQRHKTTVMQVTPTLLTRFGQRTLKQEVLSSASPLRVLALGGE
ACPPPALLRSWRQEHNRTSVYNIYGITEVSCWACCHRIPESLLQSPAHAESFVPLGAPLM
DTRVEVRDDEGGLVTEGEGQVFIGGEERVCLLDLEETVVPGTMRASGDWVRVRGEELEYL
GRRDRLVKRHGKRVNLDSLQQLILGLPQVDACAVCLHEGLRLLAFVVPSRNQAVQQLILD
QLSLLLPSHSVPDTLLLIPALLLTPHGKVDTEALVRTFQTQRKRLCPSPGDASNLRQAVE
LLWQDVLGLPEDVPVEENSSFLSSGGDSLKALRLCEDILTATGAASADLLEVLLDGTFSD
VLSHVERAARGATSEKGPLKRRSDVPSAAPGKRERKQSAAAEERWAVKVVRRAGEVVDVS
IPETTVPDDARKQNPSRGGGVLDLSLSWASDTGRCVDASPLLLVRYRGEQSPQEGRATVI
IGSHSHRIQALDLLSGSLVWERVLGGRIEASAAVSPCGSLVVVGCYDSCVYFLCASSGDT
RWIFKTGDAVKSSPAVDPVSGLVMVGSHDGSVYALDPEVERCVWRQHCGGGAVYSSPYLH
TSLRQLYVASLGGRLLCLHPDSGEVLWSYRRDAPFFSSPNGSTGRVLIGSVDGNICCLSS
AGELMWEFLTNGPVFSSPCVWADHRRVLCGSHDGCLYCLSADGSLVWSFQTPGKVFSSPC
VFDGSAVGRRGALVGLVSTDGTVWILDGRDGRTLASFTLKGELFSSPLVWRRSLVVGCRD
DFVYCLKLAVKDEM
Download sequence
Identical sequences H3DJV0
ENSTNIP00000020796 ENSTNIP00000020796 99883.ENSTNIP00000020796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]