SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000020964 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000020964
Domain Number 1 Region: 410-798
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.87e-126
Family Ankyrin repeat 0.000000000436
Further Details:      
 
Domain Number 2 Region: 164-428
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.04e-72
Family Ankyrin repeat 0.00000368
Further Details:      
 
Domain Number 3 Region: 7-200
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.63e-49
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 4 Region: 1470-1564
Classification Level Classification E-value
Superfamily DEATH domain 9.76e-26
Family DEATH domain, DD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000020964   Gene: ENSTNIG00000017807   Transcript: ENSTNIT00000021197
Sequence length 1863
Comment pep:known_by_projection chromosome:TETRAODON8:18:609325:643951:-1 gene:ENSTNIG00000017807 transcript:ENSTNIT00000021197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSSHLQSDSNTSFLRAARAGNIDKVLDFLKNGIDISTCNQNGLNALHLAAKEGHKDLVEE
LLDRGAPVDSSTKKGNSALHIASLAGQKEVVRLLVKRGANINSQSQNGFTPLYMAAQENH
LEVVRYLLENDGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKVRLPALHIAARK
DDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVSTLLLNRGAAVDFT
ARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDQAVEILLDRG
APILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTK
LLLDKKANPNVRALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMG
HLSIVLLLLQNGASPDIRNIRGETALHMAARAGQMEVVRCLLRNGALVDAMAREDQTPLH
IASRLGKTDIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETAAVLLEAGASHSLPTKK
GFTPLHVAAKYGNLDVAKLLLQSKALPDDAGKNGLTSLHVAAHYDNQDVALLLLDKGASP
HSTAKNGYTPLHIAAKKNQTKIASALLQYGAETNILTKQGVSPLHLAAQEGHTEMTGLLL
DKGAHVNAATKSGLTPLHLTAQEDKVGAAEVLAKYDANLDQQTKLGYTPLIVACHYGNAK
MVNFLLQQGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNTTTMSGNTALSIAR
RLGYISVVDTLKVVTEEVITTTTTVTEKHKLNVPETMTEVLDVSDEEGEDTMTGDGGEYL
RAEDLRDLGDDSLPGHYLDFSYMNNMNIDRWKSDKQTNKSQHTPIHQSFTQREGFFIEDM
LTSHQVSVLSKEHEKDSFRLSWGAEHLDNVVLSSSLLHSGRSTPCLDHDNSSFLVSFMVD
ARGGAMRGCRHNGLRIIVPPRKCSAPTRVTCRLVKRHRLASMPPMVEGEGLAGRIIEVGP
TGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGTERELV
ILRSETGESWREHHCDFTEEELNQILNGMDEKLDSPEELEKKRICRIITRDFPQYFAVVS
RIKQDSHLIGPEGGVLSSTLVPQVQAVFPEGALTKKIRVGLQAQPIDGDVVKKILGNKAA
FSAIVTLEPRRRKFHKPITMTIPIPKSPNTEGPTSEFSGETPTLRLLCSITGGTTPAQWE
DITGSTPLTFVNHCVSFTTNVSARFWLIDCRQVQESVSFASQLYREIICVPYMAKFVIFA
KTLDPIEARLRCFCMTDDKMDKTLEQQENFTEVARSRDVEVLEGKPIFVDCFGNLVPLTK
SGQHHVFSFFAFKENRLALFIKIRDTAQEPCGRLSFTKEARTYRSLTHNAICNLNITLPA
YSKESDSDQDGDDEKPLTSESRSTDSQEESKEETLTIIADLLGFSWTELAKELEFSENDI
QSVRTDNPNSLQEQSHALLQRWVEREGKHATEDCLIKTLTKINRMDIVHLIETQMNKSVQ
EQTSRTYAEIEKTLDHSEDVEKVDRTLCLPEPKQSSQIAESREKDFFDHPRPESPHFASI
SFSLSPDHFRVSESTDSTGVLSPRSQIKDDTPRTGSLGKCKDTPHASTTAPKTNQSQSIT
QKAVSSTQAEGFLGPESPQRLREVVEPSQNSEVYFESGEPESEEYEDAPFVQEPLRPGHE
DSEERARSSEPSDDEFTLCEASQPPAACSAGDRTDNCLPRADDFPEFATQSVTEEKYRDE
NGHIVVKKITRKIIRKCVSAEADREEVSFEGDAFAAQEEGGYPKVVKRTVLKSEGGHTES
SNL
Download sequence
Identical sequences H3DKB8
ENSTNIP00000020961 ENSTNIP00000020964 99883.ENSTNIP00000020964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]