SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000021889 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000021889
Domain Number 1 Region: 550-728
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-45
Family DBL homology domain (DH-domain) 0.000052
Further Details:      
 
Domain Number 2 Region: 738-853
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000021889
Domain Number - Region: 241-375
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000666
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000021889   Gene: ENSTNIG00000018710   Transcript: ENSTNIT00000022125
Sequence length 890
Comment pep:known_by_projection chromosome:TETRAODON8:11:799539:805920:-1 gene:ENSTNIG00000018710 transcript:ENSTNIT00000022125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLELGIICLPGSRDRTGRSVVEVHGDRKEWMSPLMSAQNVCELLLYLHSIPRKEIQELGM
TLVINARKKAPPPNLYKALLMAQEQALHAVHSVVMLVNKDTCPRPEKYPGLQMDLVTSLK
ALNKTVDTSQLTSDLGGRFTYSHSDWLQFHQRLVSFTTDLREADSLLQKAIKKVDERSKL
DTSQQVEQCIEEQKCSMKEVLEDTRLVMLQREGGAVLARMRREDFRFPQSEDYRDALESA
TVMYNQVEEKLHTLVMRSNESLQHLDFLFRLRKMESEVLQVGKWLNLEGEQMLKDSHTAD
SLLCAEKALHHYNLFLIQAKEKQGYALSLVTEAKEIVGLGFSGPATDIFETLVRTFKSDI
DDFMLRAQERRKELETLLYVHSFCEQAAALAKECSHFLENVEQRCYSASTQSTLQMYEER
LDGEFSTLNFQAVKAKACAVGSGAAGAMKVWNAAWVQCQQLRQDLHKMPKIFPQTNGSPR
GHHSEADLRTVDPVGEDGGFSARQHLGRSLSEGSHTGFQLPSSFLPLNVRNKHCQSKTQP
LQLNLHLDHKKLQKIMEELLTTEREYVSALGYVREHYFPELERADVPQDLRGQRGIIFGN
IEKLHDFHQHHFLSELDSCVNEPFRVGRCFLRHKGSFALYALYSKNKPQSDALFISHGKA
FFKQKQMKLGDKMDLWSYLLKPVQRISKYSLLLKDILAECGPRQTKEIAEVKAALEVINF
QLRHGNNLLAMDAIRHCDVNLKEQGQLVRQDEFLVTFRKKKCFRHIFLFQELILFSKTRR
TEVGNDTYLYKQSFKTTDIGLTQNSGDTGLCFEIWFRKRKTQDTYTLQAVSPDVKEAWTG
DLERILWEQAVHNREIRMQERVFMGIGNKPFMDIKPSEAAISNRAVNCVL
Download sequence
Identical sequences H3DMZ1
99883.ENSTNIP00000021889 ENSTNIP00000021889 ENSTNIP00000021889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]