SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004724 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004724
Domain Number 1 Region: 221-462
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.32e-54
Family Decarboxylase 0.000000569
Further Details:      
 
Domain Number 2 Region: 2-193
Classification Level Classification E-value
Superfamily PRTase-like 2.36e-42
Family Phosphoribosyltransferases (PRTases) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004724   Gene: ENSTRUG00000002053   Transcript: ENSTRUT00000004752
Sequence length 468
Comment pep:known_by_projection scaffold:FUGU4:scaffold_83:86273:89529:1 gene:ENSTRUG00000002053 transcript:ENSTRUT00000004752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILKLHDVNAVKFGEYKLKSGMMTPIYIDLRVLVSYPALMNQVSCLIYQRMQEEDLRFDS
VCGVPYTALPLATIISSKHEFPMLIRRKEAKDYGTKRLVEGTIHEGETCLIIEDTVTTGT
SILETAEVLQKVGLKVTDAIVVMDRKQGAAEMLASRGIRLHPIISMFNLLDVLREAQRID
SQTAQNVRNFILDHHTFRVADAPKPSRIAHVSDRCSAKDVHPLASKLLTIMQEKQSNLCV
SADVTSSEELLQLADSLGPSICLLKTHIDILKDYAAAVGHKLQALADKHNFLIFEDRKFA
DIGNTVKHQYEGGLYQISSWSHIVNAHVVPGPGVVKGLCAVGKPLGRGCLLIAQMSSQGS
LACGDYTNAALQMAVEQSDFVMGFICSSKICSRPEFIHMTPGVQMQAGGDVLGQQYTTPE
EVIFNKGSDVIIVGRGILEAPRLEAAELYRKMGWEAYTKRLGQSGNKK
Download sequence
Identical sequences H2RX54
ENSTRUP00000004724 ENSTRUP00000004724 31033.ENSTRUP00000004724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]