SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005500 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005500
Domain Number 1 Region: 175-417
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.5e-57
Family Decarboxylase 0.000000497
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily PRTase-like 1.44e-30
Family Phosphoribosyltransferases (PRTases) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005500   Gene: ENSTRUG00000002383   Transcript: ENSTRUT00000005533
Sequence length 423
Comment pep:known_by_projection scaffold:FUGU4:scaffold_3113:4060:6849:1 gene:ENSTRUG00000002383 transcript:ENSTRUT00000005533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYQRMQEEDLRFDSVCGVPYTALPLATIISSKHEFPMLIRRKEAKDYGTKRLVEGTIHEG
ETCLIIEDTVTTGTSILETAEVLQKVGLKVTDAIVVMDRKQGAAEMLASRGIRLHPIISM
FNLLDVLREAQRIDSQTAQNVRNFILDHHTFRVADAPKPSRIAHVSDRCSAKDVHPLASK
LLTIMQEKQSNLCVSADVTSSEELLQLADSLGPSICLLKTHIDILKDYAAAVGHKLQALA
DKHNFLIFEDRKFADIGNTVKHQYEGGLYQISSWSHIVNAHVVPGPGVVKGLCAVGKPLG
RGCLLIAQMSSQGSLACGDYTNAALQMAVEQSDFVMGFICSSKICSRPEFIHMTPGVQMQ
AGGDVLGQQYTTPEEVIFNKGSDVIIVGRGILEAPDRLEAAELYRKMGWEAYTKRLGQSG
NKK
Download sequence
Identical sequences H2RZC9
ENSTRUP00000005500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]