SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005501 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005501
Domain Number 1 Region: 175-428
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.8e-58
Family Decarboxylase 0.000000442
Further Details:      
 
Domain Number 2 Region: 3-147
Classification Level Classification E-value
Superfamily PRTase-like 1.44e-30
Family Phosphoribosyltransferases (PRTases) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005501   Gene: ENSTRUG00000002383   Transcript: ENSTRUT00000005534
Sequence length 431
Comment pep:known_by_projection scaffold:FUGU4:scaffold_3113:4060:6824:1 gene:ENSTRUG00000002383 transcript:ENSTRUT00000005534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYQRMQEEDLRFDSVCGVPYTALPLATIISSKHEFPMLIRRKEAKDYGTKRLVEGTIHEG
ETCLIIEDTVTTGTSILETAEVLQKVGLKVTDAIVVMDRKQGAAEMLASRGIRLHPIISM
FNLLDVLREAQRIDSQTAQNVRNFILDHHTFSAKAGNGSEVPEKQQCVEKTTQLSYADRA
KLSNVHPLASKLLTIMQEKQSNLCVSADVTSSEELLQLADSLGPSICLLKTHIDILKDYA
AAVGHKLQALADKHNFLIFEDRKFADIGNTVKHQYEGGLYQISSWSHIVNAHVVPGPGVV
KGLCAVGKPLGRGCLLIAQMSSQGSLACGDYTNAALQMAVEQSDFVMGFICSSKICSRPE
FIHMTPGVQMQAGGDVLGQQYTTPEEVIFNKGSDVIIVGRGILEAPDRLEAAELYRKMGW
EAYTKRLGQSG
Download sequence
Identical sequences H2RZD0
31033.ENSTRUP00000005501 ENSTRUP00000005501 ENSTRUP00000005501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]