SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000015030 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000015030
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.12e-75
Family BRCA2 helical domain 0.000000835
Further Details:      
 
Domain Number 2 Region: 352-486
Classification Level Classification E-value
Superfamily BRCA2 tower domain 5.1e-51
Family BRCA2 tower domain 0.0000947
Further Details:      
 
Domain Number 3 Region: 571-707
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-41
Family Single strand DNA-binding domain, SSB 0.00012
Further Details:      
 
Domain Number 4 Region: 185-321
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-41
Family Single strand DNA-binding domain, SSB 0.00001
Further Details:      
 
Domain Number 5 Region: 324-352,487-570
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.88e-31
Family Single strand DNA-binding domain, SSB 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000015030   Gene: ENSTRUG00000006177   Transcript: ENSTRUT00000015099
Sequence length 860
Comment pep:known_by_projection scaffold:FUGU4:scaffold_19:196046:199577:1 gene:ENSTRUG00000006177 transcript:ENSTRUT00000015099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLARDMQDMRIRKKKRQTIRPLPGSLFQKKSSGVARIPFKAAVNGKPPARYTAKPLCGLG
VPLNVLEITSETAESFRFSLQHFVKLESLIDKGGIQLADGGWLIPTNDGTAGKEEFYRAL
CDTPGVDPKLMSEEWVYNHYRWIVWKQASMERSFPEEMGSLCLTPEQVLLQLKYRYDIEV
DHSRRPALRKIMEKDDTAAKTLVLCVCGVVFRGSSPKNKSFGDISTPGADPKVENPCAVV
WLTDGWYSIKAQLDGPLTSMLHRGRLPVGGKLIIHGAQLVGSENACSPLEAPVSLMLKIC
ANSSRPARWDSKLGFHRDPRPFLLPVSSLYSSGGPVGCVDIIILRSYPILWMERKPEGGT
VFRSGRAEEKEARRYNIHKEKAMEILFDKIKAEFEKEEKGNRKPQCRRTINGQNITSLQD
GEELYEAVGDDPAFLEAHLTEKQVEVLQNYKRLVMEKQQAELQDRYRRAVESAEDGVGGC
PKRDVAPVWRLCIADSMGHSGRVYQLSLWRPPSELQALLKEGCRYKVYNLTTLDSKKQGG
NATVQLTATKKTQFEHLQGSEEWLSKHFQPRVATNFVRLQDPEFNPLCSEVDLTGYVITI
IDGQGFSPAFYLADGKQNFVKVRCFSSFAQSGLEDVIKPRVLLALSNLQLRGQSTSPTPV
VYAGDLTVFSTNPKEVHLQESFSQLKTLVQGQENFFVHAEEKLSQLMSDGLSAIASPAGQ
IQTPASTVKRRGDMTDVSSNIMVINKTSKVTCQQPGRSHRFSTPINRNSTAHSSAERNPS
TIKKRKALDYLSHIPSPPPLSCLSTLSSPSVKKIFIPPRRTEIPGTLKTVKTPNQKPSNT
PVDDQWVNDEELAMIDTQAL
Download sequence
Identical sequences H2SRJ3
31033.ENSTRUP00000015030 ENSTRUP00000015030 ENSTRUP00000015030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]