SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003317 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003317
Domain Number 1 Region: 267-361
Classification Level Classification E-value
Superfamily TAFH domain-like 1.57e-32
Family TAFH domain-like 0.00000785
Further Details:      
 
Domain Number 2 Region: 552-600
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000159
Family TBP-associated factors, TAFs 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003317   Gene: ENSTRUG00000001439   Transcript: ENSTRUT00000003336
Sequence length 766
Comment pep:known_by_projection scaffold:FUGU4:scaffold_1495:506:6730:-1 gene:ENSTRUG00000001439 transcript:ENSTRUT00000003336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPGAAAASATSIIRTASPNNVTPAQRTVPTVTLVRPPVPKPSSSSPASPAACSSSGSVPD
KVEGTKPIIQAVAPAATATITSPTVLQNLRTPAPSTIAISTGGGVRPLGQQMVAPRLAQP
QQTTTSVQNIQLPPGMVLVRSESGQLLMFHQQTLAQMKAQSQSQSAITPRLSAPASTPPV
QVASLQAPAASLLNRAVAPATIIKQVSTVYTTVAGTTTLQRPPVLQNAIMLGGTVAAPGQ
PLGTATTVQPGASVPQRVTGTSATPTAFTAETLENVKKCRSFLSTLIKLTSNGKQSSETT
ANVKELIKKLLEAKIEAEDFTSRLYRELSSSPQPYLVPFLKRSLPALRQMTPDSEAFIQQ
SLLPQTNTPAAAASTALAAVVLRPPLSTAAPTSTSTSTSTALTKATVISLSQAPHSKPTL
VQLVPQQKGGVTRPQMTLAQPPVMTLQGPTHSRIIVGQLQTAVLTNSIFPRHPAVKPTLA
PAPKGVQVVSLPPPTAAQKSKEAAAGTFRDDDDINDVASMAGVNLTEESANILATNSELV
GTVTRSCKDETFLSPSLLGHRALEIGKKFGVGELGADVVRYISHAAQQRLQDLLEKVSHV
AQLRSHILKEDGRHEQVSDVRAQLKFFEQLDQLERQRKEEQEREILLKAAKSRSRQEDPE
QLRLKQKAKEMQQQELAQIRHREANLTALAAIGPRKKRKTDAPVRGASAEGSGWGPPPQP
GGSSGSGSRQFMRQRITRVNVRDLLFCLENERGTNRSQLLYKGFLK
Download sequence
Identical sequences H2RT50
ENSTRUP00000003317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]