SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003318 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003318
Domain Number 1 Region: 241-333
Classification Level Classification E-value
Superfamily TAFH domain-like 4.45e-32
Family TAFH domain-like 0.00000785
Further Details:      
 
Domain Number 2 Region: 629-677
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000018
Family TBP-associated factors, TAFs 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003318   Gene: ENSTRUG00000001439   Transcript: ENSTRUT00000003337
Sequence length 834
Comment pep:known_by_projection scaffold:FUGU4:scaffold_1495:506:6625:-1 gene:ENSTRUG00000001439 transcript:ENSTRUT00000003337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVPKPSSSSPASPAACSSSGSVPDKVEGTKPIIQAVAPAATATITSPTVLQNLRTPAPS
TIAISTGGGVRPLGQQMVAPRLAQPQQTTTSVQNIQLPPGMVLVRSESGQLLMFHQQTLA
QMKAQSQSQSAITPRLSAPASTPPVQVASLQAPAASLLNRAVAPATIIKQVSTVYTTVAG
TTTLQRPPVLQNAIMLGGTVAAPGQPLGTATTVQPGASVPQRVTGTSATPTAFTAVRALT
LNETLENVKKCRSFLSTLIKLTSNGKQSSETTANVKELIKKLLEAKIEAEDFTSRLYREL
SSSPQPYLVPFLKRSLPALRQMTPDSEAFIQQSLLPQTNTPAAAASTALAAVVLRPPLST
AAPTSTSTSTSTALTKATVISLSQAPHSKPTLVVALNSLCLLSLGSAGAAAEGGGHEATD
DVSPASRDDPPRTHSQPHHCRPAPDSTCLTVCIMGWAVFIQVCVDVLPPSGHGYSVHPLG
HPAVKPTLAPAPKGVQVVSLPPPTAAQKSKEAAAGTFRFVSAVSNSTPLCFMIWEGCPLG
FAPILTKTSAQFALTMTKHSGSGCFSVFRKRSLAASLSFMSPPSLRDDDDINDVASMAGV
NLTEESANILATNSELVGTVTRSCKDETFLSPSLLGHRALEIGKKFGVGELGADVVRYIS
HAAQQRLQDLLEKVSHVAQLRSHILKEDGRHEQVSDVRAQLKFFEQLDQLERQRKEEQER
EILLKAAKSRSRQEDPEQLRLKQKAKEMQQQELAQIRHREANLTALAAIGPRKKRKTDAP
VRGASAEPGGSSGSGSRQFMRQRITRVNVRDLLFCLENERGTNRSQLLYKGFLK
Download sequence
Identical sequences H2RT51
ENSTRUP00000003318 ENSTRUP00000003318 31033.ENSTRUP00000003318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]