SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005145 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005145
Domain Number 1 Region: 275-409,441-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-41
Family Hemopexin-like domain 0.00076
Further Details:      
 
Domain Number 2 Region: 64-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000288
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000863
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005145   Gene: ENSTRUG00000002244   Transcript: ENSTRUT00000005175
Sequence length 507
Comment pep:known_by_projection scaffold:FUGU4:scaffold_379:17755:21549:1 gene:ENSTRUG00000002244 transcript:ENSTRUT00000005175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMSSTVTFALVFLACALTLSTGQTSCKGRCGGEYYRGYTCQCDYTCLTYDECCDDYESQC
TTKNSCKGRCGEAFRRGRGCSCDPDCQKFKQCCSDFQTHCDAAAGLDQSTDSTPDSNSAE
FSKETSTVFPPATSGDEATPAAGVLTPLSPTEAETVLPDALGSTPASSDGPRLTQTPPSP
AGASASTGPKVGLTTALENFESSSSAASSPPAPTAATSKDVTTALRELLTTLIPASSDAV
RGVTRDDTTAGVTTNDPSAVTQQPAKTTYDSNDTDLCSGRPVSGVTTLRNGTMVVFRGHY
FWVLDKNKLPGAAQSITQTWGVPSPIDTVFTRCNCEGKTYIFKGNQYWRFENGAVDTGYP
KPVQSGFDGLQGHITAALSVPQYRKRRESVYFFKRGGLVQKYSYHFTPSTTCGTKPKINI
YTVRHRVSRQAAVSNLGPAINIRASWSGFPSTITAAVSVPNKRDPEGYKYYVFSRAQFYK
VGMKSERPALAAPATNTSAQNNLFKCP
Download sequence
Identical sequences H2RYC4
ENSTRUP00000005145 ENSTRUP00000005145 31033.ENSTRUP00000005145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]