SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006122 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006122
Domain Number 1 Region: 640-895
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 27-286
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-54
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 339-577
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-52
Family YWTD domain 0.00000356
Further Details:      
 
Domain Number 4 Region: 943-1198
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-38
Family YWTD domain 0.0000456
Further Details:      
 
Domain Number 5 Region: 1328-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 898-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1250-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 1290-1325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 292-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 10 Region: 597-642
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000995
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 1207-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000467
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006122   Gene: ENSTRUG00000002629   Transcript: ENSTRUT00000006160
Sequence length 1621
Comment pep:known_by_projection scaffold:FUGU4:scaffold_556:30091:44480:1 gene:ENSTRUG00000002629 transcript:ENSTRUT00000006160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HETCETEPPPATRLLLVCRREIGSGVPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAA
AVDYVYSQGLIYWSDVSEEAIKRTVFNQSGAHTVQTVIPGLASPDGLACDWLGRKLYWTD
SETNRIEVAELDGSMRKILFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNR
SMIIDKEIYWPNGLTLDYGQQKLYWADAKHSFIHRCDLDGSSREVVVKGDLPHPFALTLY
EDTLFWTDWNTHSIHSCSKHTGGEQRVVHANIFSPMDIHVFSEERQNTRASSPCLLNNGG
CSHLCLLSPSSPSYQCACPTGVQLLADGRTCRDGATQVLLLARRTDLRRISLDTPDFTDI
VLQVDDIRHAIAIDYDPVDGYIYWTDDDVKAIRRSRLDGSDAQFVVTSQVNHPDGIAVDW
IARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIE
RADLDGMERVVMVNTSLGWPNGLALDYDERKIYWGDAKTDKIEVMHMDGTGRRVLVEDKL
PHIFGFTLLGDFIYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATSVRQAAGSNAC
AHSNGGCSHLCLFKPQGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNN
NVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAV
DWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPK
IDRAAMDGSGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDL
QHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNA
CSSTNGHCSHLCLAVPVSSFVCGCPAHFSLNEDNKTCSAPTSFLLFSQKTAINRMVIDEQ
QSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSGLMGGPSQGIQLY
DLSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEQDKPRAIVVNPERGYMYFTNLL
ERSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRI
VIADSNILQPVGLTVFGKHLYWIDKQQQMIERIDKTTREGRTKVQARVPYLSDIHAVNEL
DMREYSKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGDPPTCSPEQFSCT
SGEVDCIPRAWRCDGFAECDDSSDEEDCPVCSKSEFQCDSRQCIDLSLRCNGEINCQDRS
DENKCEVRCPSDQFTCSNGQCVGKHKKCDHNMDCTDNSDEFGCLVSDPTEEPPPPPNSTI
GSIVGVVMTLFVVGAAYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHQSSLTS
SLPGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATV
RSQYTVELGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPVKSSAT
VKGYTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDS
S
Download sequence
Identical sequences H2S151
ENSTRUP00000006122 ENSTRUP00000006122 31033.ENSTRUP00000006122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]