SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009572 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009572
Domain Number 1 Region: 626-1017
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-92
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00019
Further Details:      
 
Domain Number 2 Region: 296-624
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 5.75e-65
Family Lipovitellin-phosvitin complex, superhelical domain 0.000001
Further Details:      
 
Domain Number 3 Region: 24-288
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.92e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000141
Further Details:      
 
Domain Number 4 Region: 1066-1235
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.84e-47
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009572   Gene: ENSTRUG00000004037   Transcript: ENSTRUT00000009627
Sequence length 1254
Comment pep:known_by_projection scaffold:FUGU4:scaffold_43:166027:173289:-1 gene:ENSTRUG00000004037 transcript:ENSTRUT00000009627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLLCCLVALATCQPAPYALRLNPKKIYEYRYEGSVKFGLGLSNTAESGMRLTCNLRI
RGSSEQTFVLQVSKLAFEEFNGFPGKNNFAASSKLTQHLSAQLATPFMFDYVGGHISNIR
ASSEVSDMAVNIVRGILSFFHMTLKTKERIYQLEEVSIHGTCQSTYVTEMNDETKELSVT
QVVDIDNCRDKAAKYTGVAMAVLDNVSKQKGESVMSTVRYLYSVKPTADGGIITKAHSLE
RQFFTPFNVKGGNFKMQAVKEMVLLGVTDEGREFTLGPMEHKGDLKYKFVDAGATFPMIM
QNLNDPIPKAIELIKQLAEANKYTINSATTENNIKLYQLLRVMPYEGLETMWKQFSGNTL
QRNWFLDIVPEVNDARILKFLQNRFHAQDISTAEAVQALLLSINHLQPSPELVEMAKIFL
NMTFSKSSDFLWQTAMLTYGSLVYRNCAYVTSCPINTIQQPLIDVAVESLRSGDENKMVT
VLKALGNAGHPGSVKTIMRFLPSVAASPVELPPSVLSAAVQSLRLIAVRDPHSVRDVTLK
LFLDKTIPAEIRMLAFVILFETKPSMALVSTVTTRLMEEGNLNIISPAYSYLKSLATSTT
PENHFLSSVCNVAVKILGPKFGRLSYRYSKVVRLDWFNDDFLIGTATEMFMLRRAANVFP
TEIIMKSKFLFIGRILELLELGVRAEGIMEVIRSDAHADFGFNDFKSVFNVLKNLENLPT
DKPVLTAYSRLSGQEWFFLNINKDLILKVIKALEPSAGKESPLWDLIHRLLEGWSWHRVK
PFLTFEARYFQATSLGLPLEISKYYQSVSAVTVNAKAVVNPPLTETLGQLLSSEVSLESD
GFIGVTKDFWLFYGISTELFQCGSELKSKIPVSIPWRFTAKVNIKKKKFEIDFPLFKEEF
EVASISSNVYAVSRNIEDPAQMTPFFPVALEPNKEVPTVLEAEDEQMLKANSWHSSHKYC
AESKVYGLGLCAVSELRRQYYHEEYPLYYFLGFTHMAIKAVPIQAVKPVEKIHLEFDLHS
SKLSMSTHQVLDTVRNSREIPTLPSSREQGSHSSPLDVPTVDAAPQPLFSFKALAMSGSQ
RPEGYEAALYYRPEASLPNMQLNVSQVGENANWRVCMDSTMRLPSQTKANIRWGAECQSY
KMSVTAETAHLPGAKPTVKASLDWSEIPVSMAELGRRIRSYIPGITFLYGFSQQNEMNPQ
KEVSASVVVASADSVDVKVKFPEYTVFRQAIPFPLLPSNFCTFRNASVNGTQDS
Download sequence
Identical sequences H2SAZ4
ENSTRUP00000009572 ENSTRUP00000009572 31033.ENSTRUP00000009572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]