SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012084 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012084
Domain Number 1 Region: 8-238
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-77
Family Calponin-homology domain, CH-domain 0.0000937
Further Details:      
 
Domain Number 2 Region: 1304-1415
Classification Level Classification E-value
Superfamily E set domains 2.54e-33
Family Filamin repeat (rod domain) 0.0000162
Further Details:      
 
Domain Number 3 Region: 1493-1609
Classification Level Classification E-value
Superfamily E set domains 1.6e-31
Family Filamin repeat (rod domain) 0.0000287
Further Details:      
 
Domain Number 4 Region: 1037-1126
Classification Level Classification E-value
Superfamily E set domains 3.54e-30
Family Filamin repeat (rod domain) 0.00000692
Further Details:      
 
Domain Number 5 Region: 1406-1513
Classification Level Classification E-value
Superfamily E set domains 1.13e-29
Family Filamin repeat (rod domain) 0.0000341
Further Details:      
 
Domain Number 6 Region: 440-548
Classification Level Classification E-value
Superfamily E set domains 8.01e-29
Family Filamin repeat (rod domain) 0.00078
Further Details:      
 
Domain Number 7 Region: 2304-2397
Classification Level Classification E-value
Superfamily E set domains 1e-27
Family Filamin repeat (rod domain) 0.0000104
Further Details:      
 
Domain Number 8 Region: 1838-1932
Classification Level Classification E-value
Superfamily E set domains 3.34e-27
Family Filamin repeat (rod domain) 0.0000193
Further Details:      
 
Domain Number 9 Region: 2019-2114
Classification Level Classification E-value
Superfamily E set domains 1.83e-26
Family Filamin repeat (rod domain) 0.0000258
Further Details:      
 
Domain Number 10 Region: 352-450
Classification Level Classification E-value
Superfamily E set domains 2.14e-26
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 11 Region: 538-642
Classification Level Classification E-value
Superfamily E set domains 2.87e-26
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 12 Region: 721-846
Classification Level Classification E-value
Superfamily E set domains 4.34e-26
Family Filamin repeat (rod domain) 0.00099
Further Details:      
 
Domain Number 13 Region: 1214-1325
Classification Level Classification E-value
Superfamily E set domains 5.27e-26
Family Filamin repeat (rod domain) 0.0000068
Further Details:      
 
Domain Number 14 Region: 643-739
Classification Level Classification E-value
Superfamily E set domains 6.67e-26
Family Filamin repeat (rod domain) 0.00027
Further Details:      
 
Domain Number 15 Region: 1129-1238
Classification Level Classification E-value
Superfamily E set domains 1.33e-25
Family Filamin repeat (rod domain) 0.0000388
Further Details:      
 
Domain Number 16 Region: 253-349
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.00085
Further Details:      
 
Domain Number 17 Region: 2496-2588
Classification Level Classification E-value
Superfamily E set domains 4e-24
Family Filamin repeat (rod domain) 0.0000223
Further Details:      
 
Domain Number 18 Region: 2404-2494
Classification Level Classification E-value
Superfamily E set domains 4.74e-24
Family Filamin repeat (rod domain) 0.0000259
Further Details:      
 
Domain Number 19 Region: 836-941
Classification Level Classification E-value
Superfamily E set domains 2.2e-23
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 20 Region: 2625-2715
Classification Level Classification E-value
Superfamily E set domains 6.07e-23
Family Filamin repeat (rod domain) 0.0000428
Further Details:      
 
Domain Number 21 Region: 1599-1715
Classification Level Classification E-value
Superfamily E set domains 1.33e-22
Family Filamin repeat (rod domain) 0.0000323
Further Details:      
 
Domain Number 22 Region: 953-1051
Classification Level Classification E-value
Superfamily E set domains 4.09e-20
Family Filamin repeat (rod domain) 0.0018
Further Details:      
 
Domain Number 23 Region: 2237-2318
Classification Level Classification E-value
Superfamily E set domains 1.2e-19
Family Filamin repeat (rod domain) 0.00021
Further Details:      
 
Domain Number 24 Region: 1929-2017
Classification Level Classification E-value
Superfamily E set domains 2.07e-17
Family Filamin repeat (rod domain) 0.0000186
Further Details:      
 
Domain Number 25 Region: 1773-1852
Classification Level Classification E-value
Superfamily E set domains 7.34e-17
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012084   Gene: ENSTRUG00000005042   Transcript: ENSTRUT00000012144
Sequence length 2716
Comment pep:known_by_projection scaffold:FUGU4:scaffold_161:192533:226584:-1 gene:ENSTRUG00000005042 transcript:ENSTRUT00000012144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATEKDLAEDAPWKKIQQNTFTRWINEHLKCVNKRIVDLQLDLGDGLRLIALLEVLSHK
KMYRKYHPRPNFGQMKLENVSVALEFLDKENIKLVSIDSKAIVDGNLKLILGLIWTLILH
YSISMPAWEGEDEEIQAESKTPKQRLLGWIQNKVPDLPITNFSRDWSNGKALGALVDSCA
PGLCPDWETWDPVKPVENATEAMQLADDWLGIPQVIAPEEIIDPSVDEQSVMTYLSQFPK
AKLKPGAPLKPKLNPKKARAYGPGIEPSGNRVMRPAVFTVDTFSAGQGQVTVYLDHPDGT
REELKVEPNEGKKTFSVTYIPQVIGPHKVTVLFAGQQIPKSPFEVNVDKALGDASKVTVK
GPGIEPVGNIANKPTYFEICTAGAGTGDVTAMIRDPQGRQNSVEVMMEDKGDGVYRCTYR
PSQAGTHIVTITFGGVGVPKSPFNVDVGPACVPGACRASGRGLQSSGMRVKQVGDFKVDT
RNAGSGDLKVLIKGPNGAEEPVKQISSKDGAFCYEYWPSSPGKYTVSITWGGAHIPKSPF
EVTVGEEAGPQQIRAWGPGLEGGIVGKPAIFVVESVAADVGVLGFAIEGPSQAKIECEDQ
NDGSCDVSYWPTEPGEYAVHVTCDNADIEHSPFMAHIIPDNNASDPEKVQAFGPGIQKTG
CLVNQPAEFTVSAKDAGKGPLKIMAQDAEGLPVEVKVRNKGDGLYSCSYLPASPVKHTLA
ITWGGVSIPNSPFRVNMGKGSHPHMVKVFGPGVEKSGLKANEPTHFTVDCSGAGDDLGDV
SVGIKCDANMVGDREADVDFDIIPNANDTFTVKYIPPAAGKMTIKVLFTDKEVPQSPFHV
NVDPSHDASKVKAEGPGLARTGIESGKPTHFTVLTKGAGKAAVDVSFSSPVKDFDIIDNY
NYSQTVKYTPAKQGELTIVVTFGGDPIAKSPFTVGVAAPLDLDKVNVDNLDGRVEVNQEQ
KFVVDTKGAGGQGHLEVNMISPNQKVVPCKVEPHPGKADVRVVRYTPVEEGVHAINVSYD
GHTVPGSPFPVDAQLPPDPSKVKAFGPGLKGGLVGSPAEFTIDTKGAGTGGLGLTVEGPT
EAKIECSDNGDGTCSVSYLPTEPGEYLVNILFEEVHIPCSPFKADIQMPFDPSKVVASGA
GLKRAKVGETSVVNVDCSRAGPGELSLEAALDSRDKAKTEVLDNKDGTYTVTYIPLMSGM
YTLMLKYGGKPVLGFPAKVMVDPAIDTSKVKVFGPGVEGQAVFREATTDFTVDARPLTQN
GGDHVKAEVRNPSGVLTDCSVTDKADGTYSVEYTPFENGNPVQVLYDDTPVPKSPFKVSV
TEGCDPTRVVAAGPGLQNALTENTNNFNIITRGAGIGGLGITVEGPSESKMSCKDNKDGS
CSVEYIPFSAGLYDINITYGGEHIPGSPFKVPVTDVVDPSKVKVTGPGVGSNVRAKVPQT
FTVDCRKAGVAPLAVDVTGPKGVREAVEVTDGGDGKHVVSYTPKVEGLYSVAVKYAEEDV
PRSPFKFRVLPTHDASKVRASGPGLTSGVPASFPVEFNIDTKDAGEGQLSVLITDQDGKM
KQPSIEDGGDGTYRVSYVPDRTGRYTIVIGYGGDDIPASPYRVRATATGDASKCTVTVAE
ILIKYPAGPGVGPRVAIGEELGMVVNTKGAGKGKVSCVVVQPDGSEVEAKVLENEDGTFD
IFYTAPAPGNYVIYVRFGGENIPHSPFNVMATDEVPVMQEQMSLQQRAAPPGAGFQPWVP
PPPTDTHVTADGFEPVGSSINGSGFRPFDVVIPFSFRKGEITGEVFMPSGKSTQPTITDN
LDGTVTVLYSPTEAGLHEMHIKYNGAHIPESPLQFYVNHANSPSVTAYGPGLSYGIANKT
AMFTVFTEDAYEGGLDLAIEGPSKAEINCVDNKDGTCSVSYLPTLPGDYNILVKYNEDHI
PGSPFTAKITEDNQRRSQVKLGTAADFSLDINETDLSVLTASIQAPSGRDEPCLLKRMAN
NHIGISFIPREVGEHRVSILKNGQHVANSPISIMVIQSEIGNASQVRAYGDGLVQGTTFN
NSSFIVDTRDAGYGGLALSVEGPSKVDIQTEDMEDGTCQVTYCPTEPGNYFVSIRFAEEH
IPGSPFTVLVTGEGRIRESITRRQKAASVASVGSLCDLSLKIPGIFSPVSPYFRFLYCQE
DVSKSTQSLASHGHTLFQSLHLTFDSFVHFLQLAPSDLHFPAPPPGPPDLSLADTWNFLP
SLGLLFQRLTSQQGCQTVDMQDIRSEVRSPSGITCPAELVATGNDTYCVRFVPTEMGVHS
VSVKYKGEHVPGSPFQFTVGPLGEGGASKVRAGGPGLKGAQAGEPAEFSIWTREAGAGGL
AIAVEGPSRAEISFDDHKDGSCGVSYIAQEPGDYEISVKFNDQHIPDSPFLVPIAAPAND
ARCLTVTGLQESGLKVNHPASFAVSLNGAQGKMSAKVHSPTGALEECVITELDQDKYAIR
FIPRENGLHTIDVKFNGSHIPGSPFQVRVGEPGQAGDPGLVSVYGAGLERGTTGTQSEFI
INNTKAGPGVLTVSIEGPSKVKMECHEVPEGYKVHYTPMAPGQYLISVKYGGPYHISGSP
FKAKVTGPRLVNVTNASETSTLTVDPALRASSSLTQSSLPLFSSNASKVQSHGPGLSKAL
VGQMNRFYVDCSNAGNNMLLVGVYGPEFPCHEVLVKHEGNLKYCVTYQLKEHGNYILMVK
WGEDHIPGSPFHVTVP
Download sequence
Identical sequences H2SI52
ENSTRUP00000012084 31033.ENSTRUP00000012084 ENSTRUP00000012084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]