SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014200 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014200
Domain Number 1 Region: 373-478
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.15e-24
Family FHA domain 0.00000703
Further Details:      
 
Domain Number 2 Region: 39-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 245-346
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-22
Family Ras-binding domain, RBD 0.00000707
Further Details:      
 
Domain Number 4 Region: 956-1062
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-21
Family PDZ domain 0.00004
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000014200
Domain Number - Region: 1344-1437
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014200   Gene: ENSTRUG00000005828   Transcript: ENSTRUT00000014265
Sequence length 1784
Comment pep:known_by_projection scaffold:FUGU4:scaffold_247:261104:304397:-1 gene:ENSTRUG00000005828 transcript:ENSTRUT00000014265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSGSREEERRKLADIINHWNANRLDLFEISRPTEDLEFHGVMRFYFQDRVAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNK
DDREGRFVLKNENDILPKKSQSNGPEKEKDGVIQNFKRTLSKKEKKKEKKREKEFARIPD
GDEQALNREDGENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFMSSDG
RPDSGGTLRIYADSLKPNIPYKTILLSTRDTADFAVVEALEKYGLEKENPREYCIARLML
PLPNFKHQDDKSGKDVILDDNECPLQIFRDWPADRGALVFQLKKRPPDYPGRKGRKVDDK
AMRKDSSSSLPPEKLPYLVELSPDGSDSRDKPKLYRLQHSITEVGSDCTEDGAIQLLGPG
ILPHHCNLMHTDGMVTVTPHGPDADTFVDGQRVTETTVLRPGSTLQFGSAHVFKFVDPMY
DQGGKKEPGAMMRSRHKSGSVPETTFDLHGDIHSGAALPTSKVSHTRTHTHTHSSGKLEM
ERGMVKPMMRGEQQDSRSQDGAEKAELTLPASIEFRDNSEDTFLSAIINYTNSSTVHFKL
SPTYVLYMACRFVLSPSYRPDMSPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWM
ANASELLNFIKQDRDLNRVTLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFLDDPEEH
NPQRPKIEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDKESGLCC
HYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYSMQDVQNIHNTCFK
LNSLQLHALMTNYHCAPDEPYIPPELIDHVVAVAENTADELARSDGREVQLEEDPDLQLP
FLLPEDGYSCDVVRSVPNGLQDFLDPLLQRGFCRLVPHPRSPGTWTVHFEGANCDSHFSA
ADSSEMPMRKEPEVVTVTLKKHNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADDGRLAA
GDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRSS
DRGRDKNGKLRPKSEGFELYNNSVQNGSQEGTQAGWDSYPEPKKMSSEDRLLKNRADHRS
SPNVANQGQSPAGKAAYPGGPGTKITSVSTGNLCADDEPSPPRPEAYPIPTQAYPREYFT
IPASKSQDRVIGPGQGPSQHWQGLEDRERLPVVDNIHNSMQVEQLHRIPKEQLCQALSFS
PQRIGHFSEGIGGPDHWAPQPQVSSSLESSTSSQEHLNFSASSSSSNKTPNQKTGPGRWK
TPNAPLAMQPHSAQAPSRSDLPPPPPPPPTTYPDPYDHYDPQPDLPLPPPPSAISPVTAQ
QTADRKKREEQQRWYEKEKARLEEERERKRREQERKLGQIRANPVVPVQPHNNGGSMPPP
HLQPCMDTVIRELLPQQQPRTIERRDLQYITISKEELASSDSLSPDPWKRDAREKAEKQQ
QLHIVDLLDKEIQELQAKPERTAEESDRLRKLMLEWQFQKRLQESKQSDDDDEEEDDEDV
DTMLIMQRLEAEKRARLQDEERRRKQQLEEIRKREAEERAKQEEERRWREEERSRREAEE
KRRQEEEYYTRLEAERRRQHEEAERKLLTPDEPAGLYRPPLPRDYQPPAPHNPTNTPPPP
PQRNTSYLKTQVTSPDTLYTAKFVSYAGDEDEDEDAVNNGGGGSHSGQVKLSATRKSYGD
LPASGSPNYYRPQPPPTARKPRPVSDGIALSGSFQPPFHNSNST
Download sequence
Identical sequences H2SP63
ENSTRUP00000014200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]