SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014201 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014201
Domain Number 1 Region: 972-1079
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-23
Family PDZ domain 0.0000361
Further Details:      
 
Domain Number 2 Region: 39-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.95e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 246-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.53e-23
Family Ras-binding domain, RBD 0.00000707
Further Details:      
 
Domain Number 4 Region: 393-494
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.81e-22
Family FHA domain 0.0000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014201   Gene: ENSTRUG00000005828   Transcript: ENSTRUT00000014266
Sequence length 1654
Comment pep:known_by_projection scaffold:FUGU4:scaffold_247:264099:304397:-1 gene:ENSTRUG00000005828 transcript:ENSTRUT00000014266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSGSREEERRKLADIINHWNANRLDLFEISRPTEDLEFHGVMRFYFQDRVAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERQLDLDEKPLVVQLNWNK
DDREGRFVLKNENDILPKQKSQSNGPEKEKDGVIQNFKRTLSKKEKKKEKKREKEFARIP
DGDEQALNREDGENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFMSSD
GRPDSGGTLRIYADSLKPNIPYKTILLSTRDTADFAVVEALEKYGLEKENPREYCIARLM
LPLPNFKHQDDKSGKDVILDDNECPLQIFRDWPADRGALVFQLKKRPPDYPGRKGRKVDD
KAMRKDSSSSLPPEKLPYLVELSPGRGNHYAYYAYRHHEDGSDSRDKPKLYRLQHSITEV
GSDCTEDGAIQLLGPGILPHHCNLMHTDGMVTVTPHGPDADTFVDGQRVTETTVLRPGST
LQFGSAHVFKFVDPMYDQGGKKEPGAMMRSRHKSGSVPETTFDLHGDIHSGAALPTSKVS
HTRTHTHTHSSGKLEMERGMVKPMMRGEQQDSRSQDGAEKAELTLPASIEFRDNSEDTFL
SAIINYTNSSTVHFKLSPTYVLYMACRFVLSPSYRPDMSPSERTHKVIAIVNKMVSMMEG
VIQKQKNIAGALAFWMANASELLNFIKQDRDLNRVTLDAQDILAHLVQMAFKYLVHCLQA
DLNNYMPAFLDDPEEHNPQRPKIEDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINM
WLFNKLVTDKESGLCCHYWGAILRQQLSHIEAWAEKQGLELAADCHLSRIVQATTLLTMD
KYSMQDVQNIHNTCFKLNSLQLHALMTNYHCAPDEPYIPPELIDHVVAVAENTADELARS
DGREVQLEEDPDLQLPFLLPEDGYSCDVVRSVPNGLQDFLDPLLQRGFCRLVPHPRSPGT
WTVHFEGANCDSHFSAADSSEMPMRKEPEVVTVTLKKHNGMGLSIVAAKGAGQEKLGIYI
KSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTGSVVTLEVAKQGAIYH
GLATLLNQPSPMMQRSSDRGRDKNGKLRPKSEGFELYNNSVQNGSQEGTQAGWDSYPEPK
KMSSEDRLLKNRADHRSSPNVANQGQSPAGKAAYPGGPGTKITSVSTGNLCADDEPSPPR
PEAYPIPTQAYPREYFTIPASKSQDRVIGPGQGPSQHWQGLEDRERLPVVDNIHNSMQVE
QLHRIPKEQLCQALSFSPQRIGHFSEGIGGPDHWAPQPQVSSSLESSTSSQEHLNFSASS
SSSNKTPNQKTGPGRWKTPNAPLAMQPHSAQAPSRSDLPPPPPPPPTTYPDPYDHYDPQP
DLPLPPPPSAISPVTAQQTADRKKREEQQRWYEKEKARLEEERERKRREQERKLGQIRAN
PVVPVQPHNNGGSMPPPHLQPCMDTVIRELLPQQQPRTIERRDLQYITISKEELASSDSL
SPDPWKRDAREKAEKQQQLHIVDLLDKEIQELQAKPERTAEESDRLRKLMLEWQFQKRLQ
ESKQSDDDDEEEDDEDVDTMLIMQRLEAEKRARQNAVPAISVLDLLQDEERRRKQQLEEI
RKREAEERAKQEEERRWREEERSRREAEEKVSLQ
Download sequence
Identical sequences H2SP64
ENSTRUP00000014201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]